Citrus Sinensis ID: 011876
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 475 | ||||||
| 290361322 | 664 | zeaxanthin epoxidase [Citrus unshiu] | 1.0 | 0.715 | 0.995 | 0.0 | |
| 290361326 | 664 | zeaxanthin epoxidase [Citrus sinensis] | 1.0 | 0.715 | 0.991 | 0.0 | |
| 17402597 | 664 | zeaxanthin epoxidase [Citrus unshiu] | 1.0 | 0.715 | 0.993 | 0.0 | |
| 190576749 | 664 | zeaxanthin epoxidase [Citrus maxima] | 1.0 | 0.715 | 0.972 | 0.0 | |
| 290361328 | 664 | zeaxanthin epoxidase [Citrus sinensis] | 1.0 | 0.715 | 0.972 | 0.0 | |
| 290361324 | 664 | zeaxanthin epoxidase [Citrus unshiu] | 1.0 | 0.715 | 0.972 | 0.0 | |
| 225438718 | 658 | PREDICTED: zeaxanthin epoxidase, chlorop | 0.989 | 0.714 | 0.789 | 0.0 | |
| 38112202 | 658 | zeaxanthin epoxidase [Vitis vinifera] | 0.989 | 0.714 | 0.789 | 0.0 | |
| 399158079 | 658 | zeaxanthin epoxidase 1 [Vitis vinifera] | 0.989 | 0.714 | 0.787 | 0.0 | |
| 224084342 | 692 | predicted protein [Populus trichocarpa] | 0.995 | 0.683 | 0.732 | 0.0 |
| >gi|290361322|dbj|BAI79257.1| zeaxanthin epoxidase [Citrus unshiu] | Back alignment and taxonomy information |
|---|
Score = 981 bits (2537), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 473/475 (99%), Positives = 473/475 (99%)
Query: 1 MTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKN 60
MTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKN
Sbjct: 190 MTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKN 249
Query: 61 LFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEP 120
LFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEP
Sbjct: 250 LFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEP 309
Query: 121 AGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLG 180
AGGVD PEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLG
Sbjct: 310 AGGVDDPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLG 369
Query: 181 DSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVA 240
DSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVA
Sbjct: 370 DSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVA 429
Query: 241 VIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLG 300
VIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLG
Sbjct: 430 VIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLG 489
Query: 301 GNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSV 360
GNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSV
Sbjct: 490 GNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSV 549
Query: 361 SHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNE 420
SHENEPYLIGSESHEDF RTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNE
Sbjct: 550 SHENEPYLIGSESHEDFPRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNE 609
Query: 421 GRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVIGTPPNNNSERKEAGEILQAV 475
GRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVIGTPPNNNSERKEAGEILQAV
Sbjct: 610 GRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVIGTPPNNNSERKEAGEILQAV 664
|
Source: Citrus unshiu Species: Citrus unshiu Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|290361326|dbj|BAI79259.1| zeaxanthin epoxidase [Citrus sinensis] | Back alignment and taxonomy information |
|---|
| >gi|17402597|dbj|BAB78733.1| zeaxanthin epoxidase [Citrus unshiu] | Back alignment and taxonomy information |
|---|
| >gi|190576749|gb|ACE79170.1| zeaxanthin epoxidase [Citrus maxima] | Back alignment and taxonomy information |
|---|
| >gi|290361328|dbj|BAI79260.1| zeaxanthin epoxidase [Citrus sinensis] | Back alignment and taxonomy information |
|---|
| >gi|290361324|dbj|BAI79258.1| zeaxanthin epoxidase [Citrus unshiu] | Back alignment and taxonomy information |
|---|
| >gi|225438718|ref|XP_002282543.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Vitis vinifera] gi|296082420|emb|CBI21425.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|38112202|gb|AAR11195.1| zeaxanthin epoxidase [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|399158079|gb|AFP28801.1| zeaxanthin epoxidase 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224084342|ref|XP_002307265.1| predicted protein [Populus trichocarpa] gi|222856714|gb|EEE94261.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 475 | ||||||
| TAIR|locus:2158083 | 667 | ABA1 "ABA DEFICIENT 1" [Arabid | 0.993 | 0.707 | 0.727 | 4.4e-194 | |
| UNIPROTKB|Q0JCU7 | 659 | ZEP "Zeaxanthin epoxidase, chl | 0.987 | 0.711 | 0.708 | 4.3e-180 | |
| UNIPROTKB|A6T923 | 384 | hpxO "FAD-dependent urate hydr | 0.492 | 0.609 | 0.317 | 5.7e-20 | |
| UNIPROTKB|B5B0J6 | 384 | hpxO "FAD-dependent urate hydr | 0.498 | 0.617 | 0.304 | 2.4e-19 | |
| UNIPROTKB|B6D1N4 | 384 | hpxO "FAD-dependent urate hydr | 0.492 | 0.609 | 0.317 | 2.4e-19 | |
| UNIPROTKB|Q88FY2 | 382 | nicC "6-hydroxynicotinate 3-mo | 0.444 | 0.552 | 0.308 | 1.2e-17 | |
| UNIPROTKB|P86491 | 385 | P86491 "6-hydroxynicotinate 3- | 0.435 | 0.537 | 0.297 | 1.5e-16 | |
| TAIR|locus:2060584 | 427 | CTF2B "AT2G29720" [Arabidopsis | 0.471 | 0.524 | 0.308 | 2.4e-15 | |
| TIGR_CMR|SPO_3692 | 395 | SPO_3692 "monooxygenase, putat | 0.44 | 0.529 | 0.293 | 5.3e-15 | |
| TAIR|locus:2058723 | 439 | CTF2A "AT2G35660" [Arabidopsis | 0.463 | 0.501 | 0.307 | 4.7e-14 |
| TAIR|locus:2158083 ABA1 "ABA DEFICIENT 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1880 (666.9 bits), Expect = 4.4e-194, P = 4.4e-194
Identities = 345/474 (72%), Positives = 405/474 (85%)
Query: 1 MTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKN 60
MTLQQILA+AVG+++I NESNV+DF+D GDKV+VVLENGQ Y GDLL+GADGIWSKVR N
Sbjct: 193 MTLQQILARAVGEDVIRNESNVVDFEDSGDKVTVVLENGQRYEGDLLVGADGIWSKVRNN 252
Query: 61 LFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEP 120
LFG EA YSGYTCYTGIADF+PADIESVGYRVFLGHKQYFVSSDVG GKMQWYAFH+EP
Sbjct: 253 LFGRSEATYSGYTCYTGIADFIPADIESVGYRVFLGHKQYFVSSDVGGGKMQWYAFHEEP 312
Query: 121 AGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLG 180
AGG D P G K+RL +IF+GWCDNV+DL+ AT+EEAILRRDIYDR+P FTWG+GRVTLLG
Sbjct: 313 AGGADAPNGMKKRLFEIFDGWCDNVLDLLHATEEEAILRRDIYDRSPGFTWGKGRVTLLG 372
Query: 181 DSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVA 240
DS+HAMQPN+GQGGCMAIED +QLA+EL++A K+S E+ TP+D+VS+LK YE +RRLRVA
Sbjct: 373 DSIHAMQPNMGQGGCMAIEDSFQLALELDEAWKQSVETTTPVDVVSSLKRYEESRRLRVA 432
Query: 241 VIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLG 300
+IH +AR AA+MASTYKAYLGVGLGPLSFLTKFR+PHPGRVGGRFF+D+AMP ML WVLG
Sbjct: 433 IIHAMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFVDIAMPSMLDWVLG 492
Query: 301 GNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSV 360
GNS KL+GR P C+L+DKA D LR WF DDDALER + GEW+L+P G + VS+ + L+
Sbjct: 493 GNSEKLQGRPPSCRLTDKADDRLREWFEDDDALERTIKGEWYLIPHGDDCCVSETLCLT- 551
Query: 361 SHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNE 420
E++P ++GSE +DF IVIPS+QVSKMHAR+ YKDGAF+L+DL+SEHGTYVTDNE
Sbjct: 552 KDEDQPCIVGSEPDQDFPGMRIVIPSSQVSKMHARVIYKDGAFFLMDLRSEHGTYVTDNE 611
Query: 421 GRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVIG-TPPNNNSERKEAGEILQ 473
GRRYR + NFPARFR SD IEFGSDKKA FRVKVI TP + ++LQ
Sbjct: 612 GRRYRATPNFPARFRSSDIIEFGSDKKAAFRVKVIRKTPKSTRKNESNNDKLLQ 665
|
|
| UNIPROTKB|Q0JCU7 ZEP "Zeaxanthin epoxidase, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6T923 hpxO "FAD-dependent urate hydroxylase" [Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (taxid:272620)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B5B0J6 hpxO "FAD-dependent urate hydroxylase" [Klebsiella oxytoca (taxid:571)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B6D1N4 hpxO "FAD-dependent urate hydroxylase" [Klebsiella pneumoniae (taxid:573)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q88FY2 nicC "6-hydroxynicotinate 3-monooxygenase" [Pseudomonas putida KT2440 (taxid:160488)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P86491 P86491 "6-hydroxynicotinate 3-monooxygenase" [Pseudomonas fluorescens (taxid:294)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2060584 CTF2B "AT2G29720" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_3692 SPO_3692 "monooxygenase, putative" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2058723 CTF2A "AT2G35660" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| ZEP | SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (658 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00037718001 | • | • | 0.925 | ||||||||
| GSVIVG00007662001 | • | • | 0.925 | ||||||||
| bch1 | • | • | 0.925 | ||||||||
| GSVIVG00037315001 | • | • | 0.908 | ||||||||
| PDS1 | • | 0.483 | |||||||||
| FLC | • | 0.481 | |||||||||
| GPPS | • | 0.480 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 475 | |||
| PLN02927 | 668 | PLN02927, PLN02927, antheraxanthin epoxidase/zeaxa | 0.0 | |
| PRK06753 | 373 | PRK06753, PRK06753, hypothetical protein; Provisio | 2e-32 | |
| PRK08163 | 396 | PRK08163, PRK08163, salicylate hydroxylase; Provis | 9e-31 | |
| COG0654 | 387 | COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox | 2e-26 | |
| PRK06847 | 375 | PRK06847, PRK06847, hypothetical protein; Provisio | 5e-25 | |
| PRK07538 | 413 | PRK07538, PRK07538, hypothetical protein; Provisio | 6e-23 | |
| cd00060 | 102 | cd00060, FHA, Forkhead associated domain (FHA); fo | 7e-18 | |
| TIGR03219 | 414 | TIGR03219, salicylate_mono, salicylate 1-monooxyge | 2e-16 | |
| PRK06475 | 400 | PRK06475, PRK06475, salicylate hydroxylase; Provis | 5e-16 | |
| pfam00498 | 67 | pfam00498, FHA, FHA domain | 2e-14 | |
| PRK07588 | 391 | PRK07588, PRK07588, hypothetical protein; Provisio | 8e-12 | |
| smart00240 | 52 | smart00240, FHA, Forkhead associated domain | 7e-09 | |
| COG1716 | 191 | COG1716, COG1716, FOG: FHA domain [Signal transduc | 1e-08 | |
| pfam01494 | 349 | pfam01494, FAD_binding_3, FAD binding domain | 2e-07 | |
| PRK07236 | 386 | PRK07236, PRK07236, hypothetical protein; Provisio | 2e-06 | |
| PRK07045 | 388 | PRK07045, PRK07045, putative monooxygenase; Review | 3e-05 | |
| PRK08255 | 765 | PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; R | 3e-05 | |
| TIGR01988 | 387 | TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd | 1e-04 | |
| PRK05868 | 372 | PRK05868, PRK05868, hypothetical protein; Validate | 2e-04 | |
| TIGR03354 | 396 | TIGR03354, VI_FHA, type VI secretion system FHA do | 3e-04 | |
| TIGR01988 | 387 | TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd | 4e-04 | |
| COG3456 | 430 | COG3456, COG3456, Predicted component of the type | 4e-04 | |
| PRK06183 | 500 | PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydr | 5e-04 | |
| PRK07333 | 403 | PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl h | 0.001 | |
| PRK06185 | 407 | PRK06185, PRK06185, hypothetical protein; Provisio | 0.002 | |
| TIGR01984 | 382 | TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hy | 0.002 | |
| PRK05868 | 372 | PRK05868, PRK05868, hypothetical protein; Validate | 0.004 |
| >gnl|CDD|178515 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
Score = 747 bits (1930), Expect = 0.0
Identities = 346/474 (72%), Positives = 406/474 (85%), Gaps = 2/474 (0%)
Query: 1 MTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKN 60
MTLQQILA+AVG+++I NESNV+DF+D GDKV+VVLENGQ Y GDLL+GADGIWSKVR N
Sbjct: 194 MTLQQILARAVGEDVIRNESNVVDFEDSGDKVTVVLENGQRYEGDLLVGADGIWSKVRNN 253
Query: 61 LFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEP 120
LFG EA YSGYTCYTGIADF+PADIESVGYRVFLGHKQYFVSSDVG GKMQWYAFH+EP
Sbjct: 254 LFGRSEATYSGYTCYTGIADFIPADIESVGYRVFLGHKQYFVSSDVGGGKMQWYAFHEEP 313
Query: 121 AGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLG 180
AGG D P G K+RL +IF+GWCDNV+DL+ AT+E+AILRRDIYDR+P FTWG+GRVTLLG
Sbjct: 314 AGGADAPNGMKKRLFEIFDGWCDNVLDLLHATEEDAILRRDIYDRSPGFTWGKGRVTLLG 373
Query: 181 DSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVA 240
DS+HAMQPN+GQGGCMAIED +QLA+EL++A K+S E+ TP+D+VS+LK YE +RRLRVA
Sbjct: 374 DSIHAMQPNMGQGGCMAIEDSFQLALELDEAWKQSVETNTPVDVVSSLKRYEESRRLRVA 433
Query: 241 VIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLG 300
+IH +AR AA+MASTYKAYLGVGLGPLSFLTKFR+PHPGRVGGRFF+D+AMPLML WVLG
Sbjct: 434 IIHAMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFVDIAMPLMLDWVLG 493
Query: 301 GNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSV 360
GNS KLEGR P C+L+DKA D LR WF DDDALER + GEW+L+P G + VS+ + L+
Sbjct: 494 GNSEKLEGRPPSCRLTDKADDRLREWFEDDDALERTIKGEWYLIPHGDDCCVSETLCLT- 552
Query: 361 SHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNE 420
E++P ++GSE +DF IVIPS+QVSKMHAR+ YKDGAF+L+DL+SEHGTYVTDNE
Sbjct: 553 KDEDQPCIVGSEPDQDFPGMRIVIPSSQVSKMHARVIYKDGAFFLMDLRSEHGTYVTDNE 612
Query: 421 GRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVI-GTPPNNNSERKEAGEILQ 473
GRRYR + NFPARFR SD IEFGSDKKA FRVKVI TP + ++LQ
Sbjct: 613 GRRYRATPNFPARFRSSDIIEFGSDKKAAFRVKVIRKTPKSTRKNESNNDKLLQ 666
|
Length = 668 |
| >gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181262 PRK08163, PRK08163, salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|235874 PRK06847, PRK06847, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236046 PRK07538, PRK07538, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238017 cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >gnl|CDD|132263 TIGR03219, salicylate_mono, salicylate 1-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|180582 PRK06475, PRK06475, salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215951 pfam00498, FHA, FHA domain | Back alignment and domain information |
|---|
| >gnl|CDD|169028 PRK07588, PRK07588, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214578 smart00240, FHA, Forkhead associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|224630 COG1716, COG1716, FOG: FHA domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|216530 pfam01494, FAD_binding_3, FAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235980 PRK07236, PRK07236, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|136171 PRK07045, PRK07045, putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236203 PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >gnl|CDD|180297 PRK05868, PRK05868, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234178 TIGR03354, VI_FHA, type VI secretion system FHA domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >gnl|CDD|225987 COG3456, COG3456, Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|235727 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180935 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235729 PRK06185, PRK06185, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233669 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|180297 PRK05868, PRK05868, hypothetical protein; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 475 | |||
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 100.0 | |
| PRK06753 | 373 | hypothetical protein; Provisional | 100.0 | |
| TIGR03219 | 414 | salicylate_mono salicylate 1-monooxygenase. Member | 100.0 | |
| PRK06617 | 374 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 100.0 | |
| PRK06475 | 400 | salicylate hydroxylase; Provisional | 100.0 | |
| PRK07588 | 391 | hypothetical protein; Provisional | 100.0 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 100.0 | |
| PRK08013 | 400 | oxidoreductase; Provisional | 100.0 | |
| PRK08849 | 384 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 99.98 | |
| PRK05868 | 372 | hypothetical protein; Validated | 99.97 | |
| PRK05714 | 405 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 99.97 | |
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 99.97 | |
| PRK08850 | 405 | 2-octaprenyl-6-methoxyphenol hydroxylase; Validate | 99.97 | |
| TIGR01989 | 437 | COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T | 99.97 | |
| PRK07538 | 413 | hypothetical protein; Provisional | 99.97 | |
| PRK07045 | 388 | putative monooxygenase; Reviewed | 99.97 | |
| PRK06183 | 538 | mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va | 99.97 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 99.97 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 99.97 | |
| PRK08020 | 391 | ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin | 99.97 | |
| PRK06996 | 398 | hypothetical protein; Provisional | 99.97 | |
| PRK07494 | 388 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 99.97 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 99.97 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 99.97 | |
| PRK06834 | 488 | hypothetical protein; Provisional | 99.96 | |
| PRK07364 | 415 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 99.96 | |
| PRK07333 | 403 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 99.96 | |
| PRK08294 | 634 | phenol 2-monooxygenase; Provisional | 99.96 | |
| KOG2614 | 420 | consensus Kynurenine 3-monooxygenase and related f | 99.96 | |
| PRK09126 | 392 | hypothetical protein; Provisional | 99.96 | |
| TIGR02360 | 390 | pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. | 99.96 | |
| PRK08244 | 493 | hypothetical protein; Provisional | 99.96 | |
| PRK08243 | 392 | 4-hydroxybenzoate 3-monooxygenase; Validated | 99.96 | |
| PRK06184 | 502 | hypothetical protein; Provisional | 99.95 | |
| TIGR01984 | 382 | UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T | 99.95 | |
| PRK08132 | 547 | FAD-dependent oxidoreductase; Provisional | 99.95 | |
| PRK07190 | 487 | hypothetical protein; Provisional | 99.95 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 99.95 | |
| TIGR01988 | 385 | Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub | 99.95 | |
| PRK06126 | 545 | hypothetical protein; Provisional | 99.95 | |
| PRK05732 | 395 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 99.95 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 99.95 | |
| PTZ00367 | 567 | squalene epoxidase; Provisional | 99.93 | |
| PLN02985 | 514 | squalene monooxygenase | 99.93 | |
| PRK08255 | 765 | salicylyl-CoA 5-hydroxylase; Reviewed | 99.87 | |
| KOG3855 | 481 | consensus Monooxygenase involved in coenzyme Q (ub | 99.84 | |
| TIGR02032 | 295 | GG-red-SF geranylgeranyl reductase family. This mo | 99.82 | |
| TIGR02023 | 388 | BchP-ChlP geranylgeranyl reductase. This model rep | 99.81 | |
| PLN00093 | 450 | geranylgeranyl diphosphate reductase; Provisional | 99.79 | |
| PF08491 | 276 | SE: Squalene epoxidase; InterPro: IPR013698 This d | 99.78 | |
| PRK11445 | 351 | putative oxidoreductase; Provisional | 99.77 | |
| TIGR02028 | 398 | ChlP geranylgeranyl reductase. This model represen | 99.76 | |
| PF00498 | 68 | FHA: FHA domain; InterPro: IPR000253 The forkhead- | 99.73 | |
| TIGR01790 | 388 | carotene-cycl lycopene cyclase family protein. Thi | 99.67 | |
| COG0644 | 396 | FixC Dehydrogenases (flavoproteins) [Energy produc | 99.64 | |
| PRK10015 | 429 | oxidoreductase; Provisional | 99.58 | |
| PRK10157 | 428 | putative oxidoreductase FixC; Provisional | 99.57 | |
| TIGR01789 | 370 | lycopene_cycl lycopene cyclase. This model represe | 99.57 | |
| cd00060 | 102 | FHA Forkhead associated domain (FHA); found in euk | 99.48 | |
| TIGR03354 | 396 | VI_FHA type VI secretion system FHA domain protein | 99.44 | |
| PLN02697 | 529 | lycopene epsilon cyclase | 99.39 | |
| KOG1298 | 509 | consensus Squalene monooxygenase [Lipid transport | 99.35 | |
| PLN02463 | 447 | lycopene beta cyclase | 99.34 | |
| COG1716 | 191 | FOG: FHA domain [Signal transduction mechanisms] | 99.29 | |
| KOG1882 | 293 | consensus Transcriptional regulator SNIP1, contain | 99.24 | |
| smart00240 | 52 | FHA Forkhead associated domain. Found in eukaryoti | 99.17 | |
| PF04820 | 454 | Trp_halogenase: Tryptophan halogenase; InterPro: I | 99.12 | |
| COG3456 | 430 | Predicted component of the type VI protein secreti | 99.11 | |
| KOG1881 | 793 | consensus Anion exchanger adaptor protein Kanadapt | 98.84 | |
| PF05834 | 374 | Lycopene_cycl: Lycopene cyclase protein; InterPro: | 98.83 | |
| KOG1880 | 337 | consensus Nuclear inhibitor of phosphatase-1 [Gene | 98.5 | |
| KOG0615 | 475 | consensus Serine/threonine protein kinase Chk2 and | 97.53 | |
| KOG0245 | 1221 | consensus Kinesin-like protein [Cytoskeleton] | 97.16 | |
| TIGR02500 | 410 | type_III_yscD type III secretion apparatus protein | 97.16 | |
| KOG2293 | 547 | consensus Daxx-interacting protein MSP58/p78, cont | 96.93 | |
| PRK12416 | 463 | protoporphyrinogen oxidase; Provisional | 96.76 | |
| TIGR00562 | 462 | proto_IX_ox protoporphyrinogen oxidase. This prote | 96.6 | |
| TIGR02352 | 337 | thiamin_ThiO glycine oxidase ThiO. This family con | 96.57 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 96.48 | |
| KOG1892 | 1629 | consensus Actin filament-binding protein Afadin [C | 96.4 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 96.04 | |
| TIGR01377 | 380 | soxA_mon sarcosine oxidase, monomeric form. Sarcos | 96.04 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 96.03 | |
| TIGR03197 | 381 | MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri | 95.63 | |
| PRK11883 | 451 | protoporphyrinogen oxidase; Reviewed | 95.6 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 95.45 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 95.32 | |
| TIGR02730 | 493 | carot_isom carotene isomerase. Members of this fam | 95.28 | |
| TIGR01373 | 407 | soxB sarcosine oxidase, beta subunit family, heter | 95.19 | |
| TIGR02734 | 502 | crtI_fam phytoene desaturase. Phytoene is converte | 94.95 | |
| PRK00711 | 416 | D-amino acid dehydrogenase small subunit; Validate | 94.82 | |
| PLN02612 | 567 | phytoene desaturase | 94.09 | |
| PLN02568 | 539 | polyamine oxidase | 93.85 | |
| PRK07233 | 434 | hypothetical protein; Provisional | 93.17 | |
| TIGR03467 | 419 | HpnE squalene-associated FAD-dependent desaturase. | 92.97 | |
| PRK11728 | 393 | hydroxyglutarate oxidase; Provisional | 92.75 | |
| PRK13369 | 502 | glycerol-3-phosphate dehydrogenase; Provisional | 92.44 | |
| TIGR02733 | 492 | desat_CrtD C-3',4' desaturase CrtD. Members of thi | 92.33 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 91.99 | |
| KOG0241 | 1714 | consensus Kinesin-like protein [Cytoskeleton] | 91.94 | |
| PLN02676 | 487 | polyamine oxidase | 91.74 | |
| PLN02576 | 496 | protoporphyrinogen oxidase | 91.54 | |
| COG2081 | 408 | Predicted flavoproteins [General function predicti | 90.68 | |
| PRK04176 | 257 | ribulose-1,5-biphosphate synthetase; Provisional | 90.47 | |
| PRK12266 | 508 | glpD glycerol-3-phosphate dehydrogenase; Reviewed | 89.84 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 89.48 | |
| PF01593 | 450 | Amino_oxidase: Flavin containing amine oxidoreduct | 89.03 | |
| TIGR00275 | 400 | flavoprotein, HI0933 family. The model when search | 88.81 | |
| PF13454 | 156 | NAD_binding_9: FAD-NAD(P)-binding | 87.98 | |
| COG1231 | 450 | Monoamine oxidase [Amino acid transport and metabo | 87.77 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 87.7 | |
| TIGR00292 | 254 | thiazole biosynthesis enzyme. This enzyme is invol | 87.59 | |
| PRK05257 | 494 | malate:quinone oxidoreductase; Validated | 86.85 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 86.15 | |
| COG0579 | 429 | Predicted dehydrogenase [General function predicti | 85.7 | |
| PF03486 | 409 | HI0933_like: HI0933-like protein; InterPro: IPR004 | 85.53 | |
| PLN02268 | 435 | probable polyamine oxidase | 85.51 | |
| TIGR02732 | 474 | zeta_caro_desat carotene 7,8-desaturase. Carotene | 83.81 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 83.72 | |
| PRK06116 | 450 | glutathione reductase; Validated | 83.18 | |
| PLN02464 | 627 | glycerol-3-phosphate dehydrogenase | 81.39 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 81.35 | |
| PRK09231 | 582 | fumarate reductase flavoprotein subunit; Validated | 80.86 | |
| PTZ00383 | 497 | malate:quinone oxidoreductase; Provisional | 80.63 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 80.42 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 80.19 |
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-76 Score=615.50 Aligned_cols=472 Identities=73% Similarity=1.268 Sum_probs=418.8
Q ss_pred hHHHHHhhccCCCeEEcCcEEEEEEeeCCeEEEEEcCCcEEEecEEEEecCCCCcccccccCCCCCcccceEEEEEEecc
Q 011876 2 TLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADF 81 (475)
Q Consensus 2 ~L~~~L~~~~~~~~i~~~~~v~~v~~~~~~v~v~~~dG~~~~adlvVGADG~~S~vR~~l~~~~~~~~~~~~~~~~~~~~ 81 (475)
+|+++|.++++...++++++|++++.++++|+|++++|+++++|+||||||++|.+|+.+++...+.|.++.+|+++++.
T Consensus 195 ~L~~~L~~alg~~~i~~g~~V~~I~~~~d~VtV~~~dG~ti~aDlVVGADG~~S~vR~~l~g~~~~~~sG~~~~rgi~~~ 274 (668)
T PLN02927 195 TLQQILARAVGEDVIRNESNVVDFEDSGDKVTVVLENGQRYEGDLLVGADGIWSKVRNNLFGRSEATYSGYTCYTGIADF 274 (668)
T ss_pred HHHHHHHhhCCCCEEEcCCEEEEEEEeCCEEEEEECCCCEEEcCEEEECCCCCcHHHHHhcCCCCCcccceEEEEEEcCC
Confidence 68899999887777899999999999999999999999999999999999999999999987777889999999988876
Q ss_pred CCCCcCCcceEEEecCceEEEEEeCCCCeEEEEEEEeCCCCCCCCCcchHHHHHHHhhCCChHHHHHHHhCCccceeecc
Q 011876 82 VPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRD 161 (475)
Q Consensus 82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~ 161 (475)
.+.......+..|.++..+++.++..++.+.|+.+...+....+.++...+++++.|..|++.+.+++...+...+..+.
T Consensus 275 ~p~~~~~~~~~~~~G~~~~~v~~~v~~g~~~~~~f~~~p~~~~~~~~~~~e~L~~~f~~w~~~v~elI~~t~~~~i~~~~ 354 (668)
T PLN02927 275 IPADIESVGYRVFLGHKQYFVSSDVGGGKMQWYAFHEEPAGGADAPNGMKKRLFEIFDGWCDNVLDLLHATEEDAILRRD 354 (668)
T ss_pred CcccccccceEEEEcCCeEEEEEcCCCCeEEEEEEEECCccccccchhHHHHHHHHhccCCHHHHHHHHhCccccceeee
Confidence 55443444456677888888888888887888777655433223345677889999999999999988876655566778
Q ss_pred cccCCCCccccCCcEEEEcccccccCCccccchhhhHHHHHHHHHHHHHHhhccCCCCChhhHHHHHHHHHHHhhHHHHH
Q 011876 162 IYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAV 241 (475)
Q Consensus 162 ~~~~~~~~~~~~grvvLvGDAAH~~~P~~GqG~n~al~Da~~La~~L~~~~~~~~~~~~~~~~~~~L~~Y~~~R~~~~~~ 241 (475)
++.+.+..+|++|||+|+|||||+|+|+.|||+|+||+||..|+++|..+++.....+.+.+++.+|+.|+++|++++..
T Consensus 355 iyd~~p~~~W~~grVvLiGDAAH~~~P~~GqG~n~AieDa~~La~~L~~~~~~~~~~~~~~~~~~aL~~Ye~~R~~rv~~ 434 (668)
T PLN02927 355 IYDRSPGFTWGKGRVTLLGDSIHAMQPNMGQGGCMAIEDSFQLALELDEAWKQSVETNTPVDVVSSLKRYEESRRLRVAI 434 (668)
T ss_pred EEeccCCCccccCcEEEEcCccCCCCCccccchHHHHHHHHHHHHHHHHhhccccccCCcccHHHHHHHHHHHHHHHHHH
Confidence 88877778999999999999999999999999999999999999999887653222223456889999999999999999
Q ss_pred HHHHHHHHHHHHhhhhhhhcCCCCccchhhhcccCCCCCccceeEEecchhhhHHhhhcCCCCCCCCCCCceeCCcccch
Q 011876 242 IHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASD 321 (475)
Q Consensus 242 ~~~~s~~~~~~~~~~~~~~~~~~~~~~~~r~~~l~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 321 (475)
++..+++...+...+..+.+.++.|+.+++.++++.+.+...|+++..+||+|++|+.+.+.+.++|++..|.+.|++++
T Consensus 435 i~~~ar~a~~~~~~~~~y~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 514 (668)
T PLN02927 435 IHAMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRFFVDIAMPLMLDWVLGGNSEKLEGRPPSCRLTDKADD 514 (668)
T ss_pred HHHHHHHHHHHHHHHHHHhcCCCCHHHHHHhcCCCCCCceeeeeeeecccHHHhhhhhcCCccccCCCCCccccccchhH
Confidence 99999999999988877767889999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhhhccCchHHhhhcCCcEEEEecCCCCcccccEEEeecCCCCCEEecCCCCCCCCCceeeeCCccccccceEEEEECC
Q 011876 322 NLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDG 401 (475)
Q Consensus 322 ~~~~~~~~~~~le~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~iGR~~~~~~~~~~i~~~~~~vSr~Ha~i~~~~~ 401 (475)
.+.+||++||++||+.++.|+|+|.++.+...++++|. +.++.+++|||.++++.+...|+|+++.||+.||+|.++++
T Consensus 515 ~~~~~~~~~~~~~~~~~~~w~l~~~~~~~~~~~~~~l~-~~~~~p~~iG~~~~~~~~~~~i~i~~~~vS~~Ha~i~~~~~ 593 (668)
T PLN02927 515 RLREWFEDDDALERTIKGEWYLIPHGDDCCVSETLCLT-KDEDQPCIVGSEPDQDFPGMRIVIPSSQVSKMHARVIYKDG 593 (668)
T ss_pred HHHHHhcccHHHHHhhcCCeEEEecCCCCcccceeeee-cCCCCCeEecCCCCcCCCCceEEecCCccChhHeEEEEECC
Confidence 99999999999999999999999999998888999998 88899999999999997777789999999999999999999
Q ss_pred eEEEEEcCCccceeeccCCCceeecCCCCcEEeCCCCEEEeCCCceEEEEEEEeccCCCCCcccccc--ccccccC
Q 011876 402 AFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVIGTPPNNNSERKEA--GEILQAV 475 (475)
Q Consensus 402 ~~~i~D~~S~nGt~vn~~~~~~~~~~~~~~~~l~~gd~i~~g~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~ 475 (475)
.|||+||+|+|||||||.+|+++++.|+.+..|++||+|+||+.+...|++++..++|+.. +++|. .++|++|
T Consensus 594 ~~~~~Dl~S~nGT~v~~~~~~r~~~~p~~~~~l~~~d~I~~g~~~~~~fr~~~~~~~~~~~-~~~~~~~~~~~~~~ 668 (668)
T PLN02927 594 AFFLMDLRSEHGTYVTDNEGRRYRATPNFPARFRSSDIIEFGSDKKAAFRVKVIRKTPKST-RKNESNNDKLLQTA 668 (668)
T ss_pred EEEEEECCCCCccEEeCCCCceEecCCCCceEeCCCCEEEeCCCcceeEEEEeecCCCcch-hhcccchhhhhhcC
Confidence 9999999999999999999999999999999999999999999888899999999999887 55554 5899876
|
|
| >PRK06753 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03219 salicylate_mono salicylate 1-monooxygenase | Back alignment and domain information |
|---|
| >PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK06475 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07588 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08013 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK05868 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 | Back alignment and domain information |
|---|
| >PRK07538 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07045 putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK06996 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06834 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08294 phenol 2-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >PRK09126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase | Back alignment and domain information |
|---|
| >PRK08244 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated | Back alignment and domain information |
|---|
| >PRK06184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase | Back alignment and domain information |
|---|
| >PRK08132 FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07190 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >PRK06126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >PTZ00367 squalene epoxidase; Provisional | Back alignment and domain information |
|---|
| >PLN02985 squalene monooxygenase | Back alignment and domain information |
|---|
| >PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02032 GG-red-SF geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >TIGR02023 BchP-ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PLN00093 geranylgeranyl diphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PF08491 SE: Squalene epoxidase; InterPro: IPR013698 This domain is found in squalene epoxidase (SE) and related proteins which are found in taxonomically diverse groups of eukaryotes and also in bacteria | Back alignment and domain information |
|---|
| >PRK11445 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02028 ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins | Back alignment and domain information |
|---|
| >TIGR01790 carotene-cycl lycopene cyclase family protein | Back alignment and domain information |
|---|
| >COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK10015 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK10157 putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >TIGR01789 lycopene_cycl lycopene cyclase | Back alignment and domain information |
|---|
| >cd00060 FHA Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >TIGR03354 VI_FHA type VI secretion system FHA domain protein | Back alignment and domain information |
|---|
| >PLN02697 lycopene epsilon cyclase | Back alignment and domain information |
|---|
| >KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02463 lycopene beta cyclase | Back alignment and domain information |
|---|
| >COG1716 FOG: FHA domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1882 consensus Transcriptional regulator SNIP1, contains FHA domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00240 FHA Forkhead associated domain | Back alignment and domain information |
|---|
| >PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan | Back alignment and domain information |
|---|
| >COG3456 Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1881 consensus Anion exchanger adaptor protein Kanadaptin, contains FHA domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins | Back alignment and domain information |
|---|
| >KOG1880 consensus Nuclear inhibitor of phosphatase-1 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0245 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR02500 type_III_yscD type III secretion apparatus protein, YscD/HrpQ family | Back alignment and domain information |
|---|
| >KOG2293 consensus Daxx-interacting protein MSP58/p78, contains FHA domain [Transcription; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12416 protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR00562 proto_IX_ox protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >TIGR02352 thiamin_ThiO glycine oxidase ThiO | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01377 soxA_mon sarcosine oxidase, monomeric form | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain | Back alignment and domain information |
|---|
| >PRK11883 protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02730 carot_isom carotene isomerase | Back alignment and domain information |
|---|
| >TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >TIGR02734 crtI_fam phytoene desaturase | Back alignment and domain information |
|---|
| >PRK00711 D-amino acid dehydrogenase small subunit; Validated | Back alignment and domain information |
|---|
| >PLN02612 phytoene desaturase | Back alignment and domain information |
|---|
| >PLN02568 polyamine oxidase | Back alignment and domain information |
|---|
| >PRK07233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03467 HpnE squalene-associated FAD-dependent desaturase | Back alignment and domain information |
|---|
| >PRK11728 hydroxyglutarate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK13369 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02733 desat_CrtD C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >KOG0241 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN02676 polyamine oxidase | Back alignment and domain information |
|---|
| >PLN02576 protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >COG2081 Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04176 ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) | Back alignment and domain information |
|---|
| >TIGR00275 flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >PF13454 NAD_binding_9: FAD-NAD(P)-binding | Back alignment and domain information |
|---|
| >COG1231 Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00292 thiazole biosynthesis enzyme | Back alignment and domain information |
|---|
| >PRK05257 malate:quinone oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >COG0579 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases | Back alignment and domain information |
|---|
| >PLN02268 probable polyamine oxidase | Back alignment and domain information |
|---|
| >TIGR02732 zeta_caro_desat carotene 7,8-desaturase | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PLN02464 glycerol-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK09231 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PTZ00383 malate:quinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 475 | ||||
| 3rp8_A | 407 | Crystal Structure Of Klebsiella Pneumoniae R204q Hp | 3e-22 | ||
| 3rp6_A | 407 | Crystal Structure Of Klebsiella Pneumoniae Hpxo Com | 1e-21 | ||
| 3c96_A | 410 | Crystal Structure Of The Flavin-Containing Monooxyg | 2e-17 | ||
| 2rgj_A | 402 | Crystal Structure Of Flavin-Containing Monooxygenas | 3e-16 | ||
| 3alh_A | 379 | Higher Resolution And Native Structure Of 2-Methyl- | 2e-08 | ||
| 3gmc_A | 415 | Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C | 2e-08 | ||
| 3all_A | 379 | Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C | 3e-08 | ||
| 3alk_A | 379 | Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C | 4e-08 | ||
| 3gmb_A | 415 | Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C | 2e-07 | ||
| 4hb9_A | 412 | Crystal Structure Of A Putative Fad Containing Mono | 2e-06 | ||
| 3alm_A | 379 | Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C | 3e-04 |
| >pdb|3RP8|A Chain A, Crystal Structure Of Klebsiella Pneumoniae R204q Hpxo Complexed With Fad Length = 407 | Back alignment and structure |
|
| >pdb|3RP6|A Chain A, Crystal Structure Of Klebsiella Pneumoniae Hpxo Complexed With Fad Length = 407 | Back alignment and structure |
| >pdb|3C96|A Chain A, Crystal Structure Of The Flavin-Containing Monooxygenase Phzs From Pseudomonas Aeruginosa. Northeast Structural Genomics Consortium Target Par240 Length = 410 | Back alignment and structure |
| >pdb|2RGJ|A Chain A, Crystal Structure Of Flavin-Containing Monooxygenase Phzs Length = 402 | Back alignment and structure |
| >pdb|3ALH|A Chain A, Higher Resolution And Native Structure Of 2-Methyl-3-Hydroxypyridine- 5-Carboxylic Acid Oxygenase Length = 379 | Back alignment and structure |
| >pdb|3GMC|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase With Substrate Bound Length = 415 | Back alignment and structure |
| >pdb|3ALL|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase, Mutant Y270a Length = 379 | Back alignment and structure |
| >pdb|3ALK|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase, Mutant Y270f Length = 379 | Back alignment and structure |
| >pdb|3GMB|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase Length = 415 | Back alignment and structure |
| >pdb|4HB9|A Chain A, Crystal Structure Of A Putative Fad Containing Monooxygenase From Photorhabdus Luminescens Subsp. Laumondii Tto1 (Target Psi-012791) Length = 412 | Back alignment and structure |
| >pdb|3ALM|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase, Mutant C294a Length = 379 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 475 | |||
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 8e-93 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 7e-68 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 1e-63 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 2e-61 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 8e-57 | |
| 3c4a_A | 381 | Probable tryptophan hydroxylase VIOD; alpha-beta p | 8e-25 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 6e-14 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 1e-13 | |
| 3ihm_A | 430 | Styrene monooxygenase A; rossman fold, anti-parall | 9e-13 | |
| 3va4_A | 132 | Mediator of DNA damage checkpoint protein 1; cell | 8e-12 | |
| 2jpe_A | 140 | Nuclear inhibitor of protein phosphatase 1; FHA do | 2e-11 | |
| 3els_A | 158 | PRE-mRNA leakage protein 1; intrinsically unstruct | 3e-10 | |
| 1uht_A | 118 | Expressed protein; FHA domain, beta-sandwich, anti | 4e-10 | |
| 3elv_A | 205 | PRE-mRNA leakage protein 1; intrinsically unstruct | 9e-10 | |
| 2pie_A | 138 | E3 ubiquitin-protein ligase RNF8; FHA domain, comp | 1e-09 | |
| 3gqs_A | 106 | Adenylate cyclase-like protein; FHA domain, struct | 2e-09 | |
| 1r21_A | 128 | Antigen KI-67; beta sandwich, cell cycle; NMR {Hom | 2e-09 | |
| 2xt9_B | 115 | Putative signal transduction protein GARA; lyase-s | 2e-09 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 3e-09 | |
| 2kb3_A | 143 | Oxoglutarate dehydrogenase inhibitor; forkhead-ass | 4e-09 | |
| 2csw_A | 145 | Ubiquitin ligase protein RNF8; 11-stranded beta sa | 8e-09 | |
| 2kfu_A | 162 | RV1827 PThr 22; FHA domain, phosphorylation, intra | 9e-09 | |
| 3po8_A | 100 | RV0020C protein, putative uncharacterized protein | 9e-09 | |
| 1g6g_A | 127 | Protein kinase RAD53; beta-sandwich, phosphopeptid | 1e-08 | |
| 1g3g_A | 164 | Protien kinase SPK1; FHA domain, RAD53, phosphopep | 2e-08 | |
| 1mzk_A | 139 | Kinase associated protein phosphatase; beta sandwi | 2e-08 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 3e-08 | |
| 2jqj_A | 151 | DNA damage response protein kinase DUN1; protein/p | 6e-08 | |
| 3hx1_A | 131 | SLR1951 protein; P74513_SYNY3, adenylate cyclase-l | 9e-07 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 1e-06 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 2e-06 | |
| 1lgp_A | 116 | Cell cycle checkpoint protein CHFR; FHA, tungstate | 3e-06 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 7e-06 | |
| 1wln_A | 120 | Afadin; beta sandwich, FHA domain, structural geno | 8e-06 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 2e-05 | |
| 2dkh_A | 639 | 3-hydroxybenzoate hydroxylase; flavoprotein, monoo | 2e-05 | |
| 3fm8_A | 124 | Kinesin-like protein KIF13B; kinesin, GAP, GTPase | 4e-05 | |
| 1gxc_A | 149 | CHK2, CDS1, serine/threonine-protein kinase CHK2; | 7e-05 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 8e-05 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 |
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 | Back alignment and structure |
|---|
Score = 286 bits (734), Expect = 8e-93
Identities = 75/251 (29%), Positives = 113/251 (45%), Gaps = 11/251 (4%)
Query: 1 MTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKN 60
LQ+ + G + + V ++ D V+V +G +GDLLI ADG S +R
Sbjct: 127 AELQREMLDYWGRDSVQFGKRVTRCEEDADGVTVWFTDGSSASGDLLIAADGSHSALRPW 186
Query: 61 LFGPQ-EAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKE 119
+ G + Y+GY + G+ + A + F+G + V AG+ ++
Sbjct: 187 VLGFTPQRRYAGYVNWNGLVEIDEALAPGDQWTTFVGEGKQVSLMPVSAGRFYFFFDVPL 246
Query: 120 PAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLL 179
PAG + + + L + F GW V LI A D + R +I+D P RGRV LL
Sbjct: 247 PAGLAEDRDTLRADLSRYFAGWAPPVQKLIAALDPQTTNRIEIHDIEPFSRLVRGRVALL 306
Query: 180 GDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRV 239
GD+ H+ P++GQGGC A+ED L + DI +AL+ YE R RV
Sbjct: 307 GDAGHSTTPDIGQGGCAAMEDAVVLGAVFRQT----------RDIAAALREYEAQRCDRV 356
Query: 240 AVIHGLARSAA 250
+ AR
Sbjct: 357 RDLVLKARKRC 367
|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 | Back alignment and structure |
|---|
| >3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 | Back alignment and structure |
|---|
| >3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Length = 132 | Back alignment and structure |
|---|
| >2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} Length = 140 | Back alignment and structure |
|---|
| >3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} Length = 158 | Back alignment and structure |
|---|
| >1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 Length = 118 | Back alignment and structure |
|---|
| >3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A Length = 205 | Back alignment and structure |
|---|
| >2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 Length = 138 | Back alignment and structure |
|---|
| >3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} Length = 106 | Back alignment and structure |
|---|
| >1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Length = 128 | Back alignment and structure |
|---|
| >2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} Length = 115 | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 | Back alignment and structure |
|---|
| >2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A Length = 143 | Back alignment and structure |
|---|
| >2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 Length = 145 | Back alignment and structure |
|---|
| >2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A Length = 162 | Back alignment and structure |
|---|
| >3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} PDB: 3poa_A* 2lc1_A Length = 100 | Back alignment and structure |
|---|
| >1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 Length = 127 | Back alignment and structure |
|---|
| >1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* Length = 164 | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 | Back alignment and structure |
|---|
| >2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Length = 151 | Back alignment and structure |
|---|
| >3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Length = 131 | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 | Back alignment and structure |
|---|
| >1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Length = 116 | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 | Back alignment and structure |
|---|
| >1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 Length = 120 | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 | Back alignment and structure |
|---|
| >2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Length = 639 | Back alignment and structure |
|---|
| >3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* Length = 124 | Back alignment and structure |
|---|
| >1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 Length = 149 | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 475 | |||
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 100.0 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 100.0 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 99.97 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 99.97 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 99.96 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 99.96 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 99.96 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 99.96 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 99.96 | |
| 1pn0_A | 665 | Phenol 2-monooxygenase; two dimers, TLS refinement | 99.95 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 99.94 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 99.94 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 99.94 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 99.94 | |
| 2dkh_A | 639 | 3-hydroxybenzoate hydroxylase; flavoprotein, monoo | 99.93 | |
| 3c4a_A | 381 | Probable tryptophan hydroxylase VIOD; alpha-beta p | 99.92 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 99.9 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 99.89 | |
| 3oz2_A | 397 | Digeranylgeranylglycerophospholipid reductase; str | 99.89 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 99.88 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 99.86 | |
| 2gmh_A | 584 | Electron transfer flavoprotein-ubiquinone oxidored | 99.84 | |
| 4h87_A | 130 | Kanadaptin; FHA domain of PF00498, mRNA processing | 99.83 | |
| 3va4_A | 132 | Mediator of DNA damage checkpoint protein 1; cell | 99.82 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 99.81 | |
| 3gqs_A | 106 | Adenylate cyclase-like protein; FHA domain, struct | 99.8 | |
| 2pie_A | 138 | E3 ubiquitin-protein ligase RNF8; FHA domain, comp | 99.8 | |
| 3els_A | 158 | PRE-mRNA leakage protein 1; intrinsically unstruct | 99.8 | |
| 2pyx_A | 526 | Tryptophan halogenase; structural genomics, JOI fo | 99.8 | |
| 1uht_A | 118 | Expressed protein; FHA domain, beta-sandwich, anti | 99.79 | |
| 3po8_A | 100 | RV0020C protein, putative uncharacterized protein | 99.79 | |
| 2xt9_B | 115 | Putative signal transduction protein GARA; lyase-s | 99.79 | |
| 2weu_A | 511 | Tryptophan 5-halogenase; regioselectivity, antifun | 99.78 | |
| 2kb3_A | 143 | Oxoglutarate dehydrogenase inhibitor; forkhead-ass | 99.78 | |
| 2jqj_A | 151 | DNA damage response protein kinase DUN1; protein/p | 99.78 | |
| 1gxc_A | 149 | CHK2, CDS1, serine/threonine-protein kinase CHK2; | 99.77 | |
| 2csw_A | 145 | Ubiquitin ligase protein RNF8; 11-stranded beta sa | 99.77 | |
| 2jpe_A | 140 | Nuclear inhibitor of protein phosphatase 1; FHA do | 99.76 | |
| 2kfu_A | 162 | RV1827 PThr 22; FHA domain, phosphorylation, intra | 99.76 | |
| 1lgp_A | 116 | Cell cycle checkpoint protein CHFR; FHA, tungstate | 99.76 | |
| 2aqj_A | 538 | Tryptophan halogenase, pRNA; flavin-dependent halo | 99.76 | |
| 3elv_A | 205 | PRE-mRNA leakage protein 1; intrinsically unstruct | 99.75 | |
| 1mzk_A | 139 | Kinase associated protein phosphatase; beta sandwi | 99.75 | |
| 1dmz_A | 158 | Protein (protein kinase SPK1); beta-sandwich, anti | 99.75 | |
| 1r21_A | 128 | Antigen KI-67; beta sandwich, cell cycle; NMR {Hom | 99.75 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 99.74 | |
| 3ihm_A | 430 | Styrene monooxygenase A; rossman fold, anti-parall | 99.73 | |
| 3hx1_A | 131 | SLR1951 protein; P74513_SYNY3, adenylate cyclase-l | 99.73 | |
| 2e4g_A | 550 | Tryptophan halogenase; flavin-binding, rebeccamyci | 99.73 | |
| 1qu5_A | 182 | Protein kinase SPK1; FHA, RAD53, transferase; NMR | 99.73 | |
| 1g3g_A | 164 | Protien kinase SPK1; FHA domain, RAD53, phosphopep | 99.72 | |
| 1wln_A | 120 | Afadin; beta sandwich, FHA domain, structural geno | 99.7 | |
| 1g6g_A | 127 | Protein kinase RAD53; beta-sandwich, phosphopeptid | 99.69 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 99.64 | |
| 3fm8_A | 124 | Kinesin-like protein KIF13B; kinesin, GAP, GTPase | 99.58 | |
| 4ejq_A | 154 | Kinesin-like protein KIF1A; homodimer, FHA domain, | 99.57 | |
| 3huf_A | 325 | DNA repair and telomere maintenance protein NBS1; | 99.57 | |
| 2bry_A | 497 | NEDD9 interacting protein with calponin homology a | 99.36 | |
| 3uv0_A | 102 | Mutator 2, isoform B; FHA, protein binding, dimeri | 99.35 | |
| 3kt9_A | 102 | Aprataxin; FHA domain, beta sandwich, beta sheet, | 99.34 | |
| 4a0e_A | 123 | YSCD, type III secretion protein; transport protei | 99.32 | |
| 2brf_A | 110 | Bifunctional polynucleotide phosphatase/kinase; hy | 99.2 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 99.18 | |
| 1yj5_C | 143 | 5' polynucleotide kinase-3' phosphatase FHA domai; | 99.04 | |
| 1ujx_A | 119 | Polynucleotide kinase 3'-phosphatase; DNA repair, | 99.01 | |
| 4egx_A | 184 | Kinesin-like protein KIF1A; FHA domain, transport | 99.0 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 98.97 | |
| 1wv3_A | 238 | Similar to DNA segregation ATPase and related prot | 98.6 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 97.93 | |
| 2gag_B | 405 | Heterotetrameric sarcosine oxidase beta-subunit; f | 97.89 | |
| 1y56_B | 382 | Sarcosine oxidase; dehydrogenase, protein-protein | 97.44 | |
| 3ps9_A | 676 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 97.22 | |
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 97.22 | |
| 4dgk_A | 501 | Phytoene dehydrogenase; the FAD/NAD(P)-binding ros | 97.11 | |
| 3pvc_A | 689 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 97.07 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 96.97 | |
| 2qcu_A | 501 | Aerobic glycerol-3-phosphate dehydrogenase; glycer | 96.96 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 96.85 | |
| 3nyc_A | 381 | D-arginine dehydrogenase; FAD, imino-arginine, oxi | 96.79 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 96.62 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 96.09 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 95.94 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 95.88 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 95.78 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 95.52 | |
| 3nlc_A | 549 | Uncharacterized protein VP0956; FAD-binding protei | 95.49 | |
| 3ka7_A | 425 | Oxidoreductase; structural genomics, PSI-2, protei | 95.43 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 95.32 | |
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 95.13 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 95.12 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 94.87 | |
| 1rp0_A | 284 | ARA6, thiazole biosynthetic enzyme; protein ligand | 94.66 | |
| 3axb_A | 448 | Putative oxidoreductase; dinucleotide-binding fold | 94.51 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 94.45 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 94.38 | |
| 3da1_A | 561 | Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 | 93.8 | |
| 3c4n_A | 405 | Uncharacterized protein DR_0571; alpha-beta protei | 93.75 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 93.63 | |
| 2gqf_A | 401 | Hypothetical protein HI0933; structural genomics, | 93.39 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 93.37 | |
| 1w4x_A | 542 | Phenylacetone monooxygenase; baeyer-villiger, FAD; | 93.02 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 92.98 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 92.88 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 92.76 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 92.72 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 92.66 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 92.44 | |
| 3jsk_A | 344 | Cypbp37 protein; octameric thiazole synthase, bios | 92.3 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 92.12 | |
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 92.08 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 91.47 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 91.38 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 91.37 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 91.01 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 90.86 | |
| 3ces_A | 651 | MNMG, tRNA uridine 5-carboxymethylaminomethyl modi | 90.4 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 89.96 | |
| 3cp8_A | 641 | TRNA uridine 5-carboxymethylaminomethyl modificati | 89.62 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 89.56 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 89.53 | |
| 1kf6_A | 602 | Fumarate reductase flavoprotein; respiration, fuma | 89.5 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 88.88 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 88.68 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 88.49 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 88.25 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 88.12 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 88.05 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 87.95 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 87.46 | |
| 2zxi_A | 637 | TRNA uridine 5-carboxymethylaminomethyl modificat | 87.43 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 86.08 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 85.83 | |
| 1pj5_A | 830 | N,N-dimethylglycine oxidase; channelling, FAD bind | 85.53 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 85.5 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 85.31 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 84.91 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 84.29 | |
| 4gut_A | 776 | Lysine-specific histone demethylase 1B; histone de | 83.83 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 83.21 | |
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 82.91 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 82.56 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 82.42 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 81.78 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 81.59 | |
| 2a87_A | 335 | TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL | 81.48 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 81.45 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 81.37 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 80.91 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 80.89 | |
| 2rgh_A | 571 | Alpha-glycerophosphate oxidase; flavoprotein oxida | 80.78 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 80.65 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 80.38 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 80.21 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 80.01 |
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.4e-32 Score=278.22 Aligned_cols=260 Identities=29% Similarity=0.420 Sum_probs=206.1
Q ss_pred hHHHHHhhccCCCeEEcCcEEEEEEeeCCeEEEEEcCCcEEEecEEEEecCCCCcccccccCC-CCCcccceEEEEEEec
Q 011876 2 TLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGP-QEAIYSGYTCYTGIAD 80 (475)
Q Consensus 2 ~L~~~L~~~~~~~~i~~~~~v~~v~~~~~~v~v~~~dG~~~~adlvVGADG~~S~vR~~l~~~-~~~~~~~~~~~~~~~~ 80 (475)
+|+++|.+.+....|+++++|++++.++++|+|+++||++++||+||||||.+|.||+.+.+. ..+.|.++.++.+.++
T Consensus 128 ~l~~~L~~~~~~~~i~~~~~v~~i~~~~~~v~v~~~~g~~~~a~~vV~AdG~~S~vr~~l~~~~~~~~~~~~~~~~~~~~ 207 (407)
T 3rp8_A 128 ELQREMLDYWGRDSVQFGKRVTRCEEDADGVTVWFTDGSSASGDLLIAADGSHSALRPWVLGFTPQRRYAGYVNWNGLVE 207 (407)
T ss_dssp HHHHHHHHHHCGGGEEESCCEEEEEEETTEEEEEETTSCEEEESEEEECCCTTCSSHHHHHSSCCCCEEEEEEEEEEEEE
T ss_pred HHHHHHHHhCCcCEEEECCEEEEEEecCCcEEEEEcCCCEEeeCEEEECCCcChHHHHHhcCCCCCCcccCcEEEEEEEe
Confidence 578888888776779999999999999999999999999999999999999999999999443 3666777777777655
Q ss_pred cCCCCcCCcceEEEecCceEEEEEeCCCCeEEEEEEEeCCCCCCCCCcchHHHHHHHhhCCChHHHHHHHhCCccceeec
Q 011876 81 FVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRR 160 (475)
Q Consensus 81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~ 160 (475)
..........+..|.+++.+++.+|.+++...|++....+......+....+.+.+.|..|.+.+..++..........+
T Consensus 208 ~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~ 287 (407)
T 3rp8_A 208 IDEALAPGDQWTTFVGEGKQVSLMPVSAGRFYFFFDVPLPAGLAEDRDTLRADLSRYFAGWAPPVQKLIAALDPQTTNRI 287 (407)
T ss_dssp CCTTTCCTTEEEEEEETTEEEEEEEETTTEEEEEEEEECCTTCSCCTTTHHHHHHHHTTTCCHHHHHHHHHSCGGGCEEE
T ss_pred cccccCCCCceEEEECCCcEEEEEEcCCCeEEEEEEeCCCcCCCCCchhHHHHHHHHhcCCChHHHHHHHcCCccceeEE
Confidence 32222334456677788888999999999988887776544333334566788999999999999888877765554445
Q ss_pred ccccCCCCccccCCcEEEEcccccccCCccccchhhhHHHHHHHHHHHHHHhhccCCCCChhhHHHHHHHHHHHhhHHHH
Q 011876 161 DIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVA 240 (475)
Q Consensus 161 ~~~~~~~~~~~~~grvvLvGDAAH~~~P~~GqG~n~al~Da~~La~~L~~~~~~~~~~~~~~~~~~~L~~Y~~~R~~~~~ 240 (475)
.++......+|+.+||+|+|||||.|+|++|||+|+||+||..|+++|... . +.+.+|+.|+++|++++.
T Consensus 288 ~~~~~~~~~~~~~~rv~LvGDAAh~~~P~~GqG~~~al~da~~La~~L~~~---------~-~~~~~l~~Y~~~r~~~~~ 357 (407)
T 3rp8_A 288 EIHDIEPFSRLVRGRVALLGDAGHSTTPDIGQGGCAAMEDAVVLGAVFRQT---------R-DIAAALREYEAQRCDRVR 357 (407)
T ss_dssp EEEECCCCSCCEETTEEECGGGTCCCCGGGSCHHHHHHHHHHHHHHHHHSC---------C-CHHHHHHHHHHHHHHHHH
T ss_pred eeEecCCCCceecCCEEEEEcccccCCcchhhhHHHHHHHHHHHHHHHhcC---------C-CHHHHHHHHHHHHHHHHH
Confidence 555555558999999999999999999999999999999999999999842 1 568999999999999999
Q ss_pred HHHHHHHHHHHHHhhhhhhhcCCCCccchhhhcccCCC
Q 011876 241 VIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHP 278 (475)
Q Consensus 241 ~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~r~~~l~~~ 278 (475)
.++..++.+..+.. ...++...+|+..+...
T Consensus 358 ~~~~~s~~~~~~~~-------~~~~~~~~~R~~~l~~~ 388 (407)
T 3rp8_A 358 DLVLKARKRCDITH-------GKDMQLTEAWYQELREE 388 (407)
T ss_dssp HHHHHHHHHHHHHT-------TTTHHHHHHHHHHHHSC
T ss_pred HHHHHHHHhhhhhh-------cCCHHHHHHHHHHHhhc
Confidence 99988877554432 33445667788776544
|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* | Back alignment and structure |
|---|
| >1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} | Back alignment and structure |
|---|
| >2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* | Back alignment and structure |
|---|
| >3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} | Back alignment and structure |
|---|
| >3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* | Back alignment and structure |
|---|
| >4h87_A Kanadaptin; FHA domain of PF00498, mRNA processing, nucleus, structural joint center for structural genomics, JCSG, protein structu initiative; HET: SO4; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} | Back alignment and structure |
|---|
| >2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} SCOP: b.26.1.0 PDB: 3poa_A* 2lc1_A | Back alignment and structure |
|---|
| >2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* | Back alignment and structure |
|---|
| >2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A | Back alignment and structure |
|---|
| >2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* | Back alignment and structure |
|---|
| >1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A | Back alignment and structure |
|---|
| >1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A | Back alignment and structure |
|---|
| >2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* | Back alignment and structure |
|---|
| >3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A | Back alignment and structure |
|---|
| >1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* | Back alignment and structure |
|---|
| >1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} | Back alignment and structure |
|---|
| >2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A | Back alignment and structure |
|---|
| >1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* | Back alignment and structure |
|---|
| >1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* | Back alignment and structure |
|---|
| >4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A | Back alignment and structure |
|---|
| >3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* | Back alignment and structure |
|---|
| >2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* | Back alignment and structure |
|---|
| >3uv0_A Mutator 2, isoform B; FHA, protein binding, dimerization; 1.90A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3kt9_A Aprataxin; FHA domain, beta sandwich, beta sheet, AMP hydrolase, alternative splicing, disease mutation, DNA damage, DNA repair, DNA-binding; 1.65A {Homo sapiens} SCOP: b.26.1.0 | Back alignment and structure |
|---|
| >4a0e_A YSCD, type III secretion protein; transport protein, SAD phasing, type III secretion system; 2.04A {Yersinia pestis} PDB: 4d9v_A | Back alignment and structure |
|---|
| >2brf_A Bifunctional polynucleotide phosphatase/kinase; hydrolase/transferase, FHA, forkhead-associated, PNKP, PNK, polynucleotide kinase 3' phosphatase; 1.40A {Homo sapiens} SCOP: b.26.1.2 PDB: 2w3o_A* 1yjm_A* | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >1yj5_C 5' polynucleotide kinase-3' phosphatase FHA domai; beta sandwich, P-loop, transferase; 2.80A {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1ujx_A Polynucleotide kinase 3'-phosphatase; DNA repair, FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif; NMR {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >1wv3_A Similar to DNA segregation ATPase and related proteins; structural genomics, unknown function; 1.75A {Staphylococcus aureus subsp} SCOP: b.26.1.4 b.26.1.4 | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* | Back alignment and structure |
|---|
| >2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* | Back alignment and structure |
|---|
| >1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* | Back alignment and structure |
|---|
| >4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} | Back alignment and structure |
|---|
| >3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* | Back alignment and structure |
|---|
| >3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 475 | ||||
| d1uhta_ | 118 | b.26.1.2 (A:) FHA domain containing protein At4G14 | 1e-09 | |
| d1mzka_ | 122 | b.26.1.2 (A:) Kinase associated protein phosphatas | 3e-09 | |
| d3c96a1 | 288 | c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps | 9e-08 | |
| d1pn0a1 | 360 | c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So | 3e-07 | |
| d1dmza_ | 158 | b.26.1.2 (A:) Phosphotyrosine binding domain of Ra | 5e-07 | |
| d2piea1 | 127 | b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 | 5e-06 | |
| d1g6ga_ | 127 | b.26.1.2 (A:) Phosphotyrosine binding domain of Ra | 1e-05 | |
| d2affa1 | 98 | b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapi | 1e-05 | |
| d1gxca_ | 116 | b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [T | 2e-05 | |
| d2voua1 | 265 | c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr | 4e-05 | |
| d2g1la1 | 102 | b.26.1.2 (A:498-599) Kinesin-like protein kif1c {H | 4e-05 | |
| d1wlna1 | 107 | b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [T | 8e-05 |
| >d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 118 | Back information, alignment and structure |
|---|
class: All beta proteins fold: SMAD/FHA domain superfamily: SMAD/FHA domain family: FHA domain domain: FHA domain containing protein At4G14490 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 53.5 bits (128), Expect = 1e-09
Identities = 18/91 (19%), Positives = 28/91 (30%), Gaps = 9/91 (9%)
Query: 362 HENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEG 421
+G + I I A +S H RI G + + DL S +GT + N
Sbjct: 30 KPGSTIRVGRIVRGN----EIAIKDAGISTKHLRIESDSGNWVIQDLGSSNGTLLNSN-- 83
Query: 422 RRYRVSSNFPARFRPSDTIEFGSDKKAIFRV 452
+ D I+ G +
Sbjct: 84 ---ALDPETSVNLGDGDVIKLGEYTSILVNF 111
|
| >d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 122 | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 | Back information, alignment and structure |
|---|
| >d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 158 | Back information, alignment and structure |
|---|
| >d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 127 | Back information, alignment and structure |
|---|
| >d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 | Back information, alignment and structure |
|---|
| >d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 475 | |||
| d2ff4a3 | 99 | Probable regulatory protein EmbR, C-terminal domai | 99.82 | |
| d1uhta_ | 118 | FHA domain containing protein At4G14490 {Thale cre | 99.81 | |
| d1mzka_ | 122 | Kinase associated protein phosphatase {Thale cress | 99.8 | |
| d2piea1 | 127 | Ubiquitin ligase protein RNF8 {Human (Homo sapiens | 99.79 | |
| d2affa1 | 98 | Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} | 99.75 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 99.74 | |
| d1gxca_ | 116 | Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d2brfa1 | 101 | Polynucleotide kinase 3'-phosphatase {Human (Homo | 99.7 | |
| d1lgpa_ | 113 | Cell cycle checkpoint protein Chfr {Human (Homo sa | 99.7 | |
| d1g6ga_ | 127 | Phosphotyrosine binding domain of Rad53 {Baker's y | 99.68 | |
| d1dmza_ | 158 | Phosphotyrosine binding domain of Rad53 {Baker's y | 99.64 | |
| d1wlna1 | 107 | Afadin {Mouse (Mus musculus) [TaxId: 10090]} | 99.6 | |
| d2g1la1 | 102 | Kinesin-like protein kif1c {Human (Homo sapiens) [ | 99.53 | |
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 99.51 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 99.29 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 99.25 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 97.43 | |
| d3c96a2 | 111 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 97.21 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 97.06 | |
| d2voua2 | 128 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 96.9 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 96.61 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 95.95 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 95.17 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 94.47 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 93.64 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 93.06 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 92.97 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 92.54 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 92.32 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 92.06 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 91.42 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 90.35 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 89.53 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 89.36 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 88.73 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 88.49 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 88.35 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 87.71 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 87.2 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 86.94 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 86.0 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 85.62 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 84.68 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 83.73 |
| >d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: SMAD/FHA domain superfamily: SMAD/FHA domain family: FHA domain domain: Probable regulatory protein EmbR, C-terminal domain species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.82 E-value=2e-20 Score=146.58 Aligned_cols=91 Identities=26% Similarity=0.335 Sum_probs=78.2
Q ss_pred EEEEecCCCCcccccEEEeecCCCCCEEecCCCCCCCCCceeeeCCccccccceEEEEECCeEEEEEcCCccceeeccCC
Q 011876 341 WFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNE 420 (475)
Q Consensus 341 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~iGR~~~~~~~~~~i~~~~~~vSr~Ha~i~~~~~~~~i~D~~S~nGt~vn~~~ 420 (475)
++|.....+ +.++|. ...++|||+++|+ |+++++.|||.||+|.++++.|+|+|++|+|||||||.
T Consensus 7 ~~l~~~~~G----~~~~l~----~~~~~IGR~~~~d-----i~l~d~~VSr~Ha~i~~~~~~~~i~Dl~S~nGt~vNg~- 72 (99)
T d2ff4a3 7 AYLHDIASG----RGYPLQ----AAATRIGRLHDND-----IVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHE- 72 (99)
T ss_dssp CEEEETTTC----CEEECC----SSEEEEESSTTSS-----EECCCTTSCTTCEEEEECSSCEEEEECSCSSCCEETTE-
T ss_pred EEEEcCCCC----CEEEEC----CCCEEEeeCcCCC-----EEECCccccceeEEEEEeCCEEEEEECCCcCCCeECCE-
Confidence 455555544 889998 4459999999887 99999999999999999999999999999999999999
Q ss_pred CceeecCCCCcEEeCCCCEEEeCCCceEEEEEEE
Q 011876 421 GRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKV 454 (475)
Q Consensus 421 ~~~~~~~~~~~~~l~~gd~i~~g~~~~~~~~~~~ 454 (475)
++. .+++|++||+|+||+. .|+|++
T Consensus 73 ----~i~--~~~~L~~Gd~i~iG~~---~~~f~~ 97 (99)
T d2ff4a3 73 ----RIR--SAVTLNDGDHIRICDH---EFTFQI 97 (99)
T ss_dssp ----ECS--SEEEECTTCEEEETTE---EEEEEC
T ss_pred ----EcC--CceECCCCCEEEECCE---EEEEEE
Confidence 885 4688999999999998 555554
|
| >d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d3c96a2 d.16.1.2 (A:183-293) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2voua2 d.16.1.2 (A:164-291) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|