Citrus Sinensis ID: 011877

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-----

MSEKFSPTLRIGDLSDFIAPSQNCVVSLKKATFKNPDKPQVSTSSKQQAEPVKISLKDCLACSGCITSAETVMLEKQSLDEFLSNINKGKAVIISLSPQSRASLAEHFGISPLQVFKKLTTFLKSLGVKSIFDTSCSRDLTLIEACNEFIARYKQSQESDDERSNSSLPMLSSACPGWICYAEKQLGSYILPYISSVKSPQQTIGATIKHHICQKLGFRPDEIYHVTVMPCYDKKLEAAREDFVFQLDSQEETYRDEGLEIPEVDSVLTTGEVLDLIQLKAVNFEALEESPLDKMLTNVDDEGHLYGVAGSSGGYAETVFRHAAKTLFGKVIEGHLEFKTIRNSDFREVALEVEGKTLLKFALCYGFQNLQNIVRKVKMRKCDYQFVEVMACPSGCLNGGGQIKPKPGQSPKELIKTLETIYLENVMLADPFKNPLVRSLYDEWLEQPGSEKAKKHVHTEYHPVVKSITAQLHNW

ccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccHHHHHHHHHHcccHHHHHHHHcccccEEEEEcHHHHHHHHHHHccccHHHHHHHHHHHHHccccEEEcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEEEEccccHHHHHccccccccccccccccccccccccccCEEccHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccEEEEEcccccCEEEEEEEccEEEEEEEEEEcHHHHHHHHHHHHcccccccEEEEcccccccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccccccccCEcccccccccccccc

*****SP**RIGDLSDFIAPSQNCVVSLKKAT********************KISLKDCLACSGCITSAETVMLEKQSLDEFLSNINKGKAVIISLSPQSRASLAEHFGISPLQVFKKLTTFLKSLGVKSIFDTSCSRDLTLIEACNEFIARY***************PMLSSACPGWICYAEKQLGSYILPYISSVKSPQQTIGATIKHHICQKLGFRPDEIYHVTVMPCYDKKLEAAREDFVFQLDSQEETYRDEGLEIPEVDSVLTTGEVLDLIQLKAVNFEALEESPLDKMLTNVDDEGHLYGVAGSSGGYAETVFRHAAKTLFGKVIEGHLEFKTIRNSDFREVALEVEGKTLLKFALCYGFQNLQNIVRKVKMRKCDYQFVEVMACPSGCLNGGG***********ELIKTLETIYLENVMLADPFKNPLVRSLYDEWLEQPGSEKAKKHVHTEYHPVV*S******NW

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable cytosolic Fe-S cluster assembly factor GA29080	Component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for maturation of extramitochondrial Fe/S proteins.	probable	B5DK31
Cytosolic Fe-S cluster assembly factor narfl	Component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for maturation of extramitochondrial Fe/S proteins.	probable	A8WH18
Probable cytosolic Fe-S cluster assembly factor oxy-4	Component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for maturation of extramitochondrial Fe/S proteins.	probable	Q9N392

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LX4, chain A
Confidence level:very confident
Coverage over the Query: 76-246,260-466
View the alignment between query and template
View the model in PyMOL

Template: 1HFE, chain L
Confidence level:very confident
Coverage over the Query: 39-246,260-414
View the alignment between query and template
View the model in PyMOL