Citrus Sinensis ID: 011884

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-----

MGISSLFPVQVAVWQETIGPGLFERDLCINSPTGSGKTLSYALPIVQTLSNRAVRCLRALVVLPTRDLALQVNSARCKYCCKNIFGLIADHSIAEMCVQFDSLLFISLPQVKDVFAAIAPAVGLSVGLAVGQSSIADEISELIKRPKLEAGICYDPEDVLQELQSAVDILVATPGRLMDHINATRGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQLTRSDNENRFSDASTFLPSAFGSLKTIRRCGVERGFKDKPYPRLVKMVLSATLTQDPNKLAQLDLHHPLFLTTGETRYKLPERLESYKLICESKLKPLYLVALLQSLGEEKCIVFTSSVESTHRLCTLLNHFGELRIKIKEYSGLQRQSVRSKTLKAFREGKIQVLVSSDAMTRGMDVEGVNNVVNYDKPAYIKTYIHRAGRTARAGQLGRCFTLLHKDEVKRFKKLLQKADNDSCPIHSIPSSLIESLRPVYKSGDV

cccccccHHHHHcHHHHHccccccccEEEEccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHccccccccccHHHHHHHHHccccccEEEEEEccccHHHHHHHHHcccccccccccccHHHHHHHcccccEEEEcccHHHHHHccccccccccccEEEEEcccHHHHcccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccHHHHHHHcccccCEEEEccccccccccEEEEEEEccccccHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHcccccccEEEccccccHHHHHHHHHHHHcccccEEEEEcccccccccccccEEEccccccccccccccccccccccccccEEEEEcHHHHHHHHHHHHHHcccccccccccHHHHHHHccccccccc

MGISSLFPVQVAVWQETIGPGLFERDLCINSPTGSGKTLSYALPIVQTLSNRAVRCLRALVVLPTRDLALQVNSARCKYCCKNIFGLIADHSIAEMCVQFDSLLFISLPQVKDVFAAIAPAVGLSVGLAVGQSSIADEISELIKRPKLEAGICYDPEDVLQELQSAVDILVATPGRLMDHINATRGFTLEHLCYLVVDETDRLLREAYQAWLPTVLQLTRS*****FSDASTFLPSAFGSLKTIRRCGVERGFKDKPYPRLVKMVLSATLTQDPNKLAQLDLHHPLFLTTGETRYKLPERLESYKLICESKLKPLYLVALLQSLGEEKCIVFTSSVESTHRLCTLLNHFGELRIKIKEYSGLQRQSVRSKTLKAFREGKIQVLVSSDAMTRGMDVEGVNNVVNYDKPAYIKTYIHRAGRTARAGQLGRCFTLLHKDEVKRFKKLLQK*********************VY*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DEAD-box ATP-dependent RNA helicase 1		probable	Q0DWT8
DEAD-box ATP-dependent RNA helicase 1		probable	Q7FGZ2

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.6.-.-	Acting on acid anhydrides.	probable
3.6.4.-	Acting on acid anhydrides; involved in cellular and subcellular movement.	probable
3.6.4.13	RNA helicase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DB3, chain A
Confidence level:very confident
Coverage over the Query: 1-73,113-140,162-222,259-463
View the alignment between query and template
View the model in PyMOL

Template: 3SQW, chain A
Confidence level:very confident
Coverage over the Query: 1-79,115-143,164-225,257-450
View the alignment between query and template
View the model in PyMOL

Template: 1NKT, chain A
Confidence level:confident
Coverage over the Query: 1-71,111-139,163-465
View the alignment between query and template
View the model in PyMOL

Template: 4A15, chain A
Confidence level:confident
Coverage over the Query: 7-437
View the alignment between query and template
View the model in PyMOL