Citrus Sinensis ID: 011896


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-----
MGGGFRVLHLVRPFLPFLPEVQSADRKIPFREKVIYTVISLFIFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELGITPIVTSGLVMQLLAGSKIIEVDNNVREDRALLNGAQKLLGILIAIGEAVAYVMSGMYGSVSQLGAGNAILIILQLCFAGIIVICLDELLQKGYGLGSGISLFIATNICESIIWKAFSPTTINSGRGAEFEGAVIALFHLLITKQNKVGALREAFYRQNLPNITNLLATVLVFLIVVYFQGFKVVLPVRSKNARGQQGAYPIKLFYTSNMPIILQSALVSNLYFISQLLYRKYSGNFFVNLLGKWKESEYSGHSIPVGGLAYYVTAPASLADMAANPFHALFYLVFMLTACALFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGVCIGALTVLADFMGAIGSGTGILLAVTIIYQYFETFEKERASELGFFGF
cccccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccHHHcccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHEEEEEccEEEEEECcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccc
***GFRVLHLVRPFLPFLPEVQSADRKIPFREKVIYTVISLFIFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELGITPIVTSGLVMQLLAGSKIIEVDNNVREDRALLNGAQKLLGILIAIGEAVAYVMSGMYGSVSQLGAGNAILIILQLCFAGIIVICLDELLQKGYGLGSGISLFIATNICESIIWKAFSPTTINSGRGAEFEGAVIALFHLLITKQNKVGALREAFYRQNLPNITNLLATVLVFLIVVYFQGFKVVLPVRSKNARGQQGAYPIKLFYTSNMPIILQSALVSNLYFISQLLYRKYSGNFFVNLLGKWKESEYSGHSIPVGGLAYYVTAPASLADMAANPFHALFYLVFMLTACALFSKTWIEVSGSSA************VMPGHRDSNLQKELNRYIPTAAAFGGVCIGALTVLADFMGAIGSGTGILLAVTIIYQYFETFEKE**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGGFRVLHLVRPFLPFLPEVQSADRKIPFREKVIYTVISLFIFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELGITPIVTSGLVMQLLAGSKIIEVDNNVREDRALLNGAQKLLGILIAIGEAVAYVMSGMYGSVSQLGAGNAILIILQLCFAGIIVICLDELLQKGYGLGSGISLFIATNICESIIWKAFSPTTINSGRGAEFEGAVIALFHLLITKQNKVGALREAFYRQNLPNITNLLATVLVFLIVVYFQGFKVVLPVRSKNARGQQGAYPIKLFYTSNMPIILQSALVSNLYFISQLLYRKYSGNFFVNLLGKWKESEYSGHSIPVGGLAYYVTAPASLADMAANPFHALFYLVFMLTACALFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGVCIGALTVLADFMGAIGSGTGILLAVTIIYQYFETFEKERASELGFFGF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein transport protein Sec61 subunit alpha Appears to play a crucial role in the insertion of secretory and membrane polypeptides into the ER. It is required for assembly of membrane and secretory proteins. Found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins.confidentQ54XK2
Protein transport protein SEC61 subunit alpha Appears to play a crucial role in the insertion of secretory and membrane polypeptides into the ER. It is required for assembly of membrane and secretory proteins and is essential for cell growth. It interacts with other membrane proteins required for protein translocation. Upon binding to SEC62/63 complex, secretory precursor polypeptides may engage SEC61 to begin membrane penetration event. A cycle of assembly and disassembly of SEC62/63 from SEC61 may govern the activity of the translocase.probableP78979
Protein transport protein Sec61 subunit alpha-like 2 Appears to play a crucial role in the insertion of secretory and membrane polypeptides into the ER. It is required for assembly of membrane and secretory proteins. Found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins.probableQ90YL4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WWB, chain A
Confidence level:very confident
Coverage over the Query: 4-474
View the alignment between query and template
View the model in PyMOL