Citrus Sinensis ID: 011910


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-----
MDIEEDIRSLQLDSAEENNGVVNPGDARPEEVEVVDKMEEDSEEVQAVSQPVHPEPKVKHKEVSAVEDAESQQETEGNNKRHLNVVFIGHVDAGKSTTGGQILFLSGQVDDRTIQKYEKEAKDKSRESWYMAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGFEKGGQTREHVMLAKTLGVTKLLLVVNKMDDHTVNWSKERYDEIESKMTPFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVELLHQIDLKTKKPMKKKVLFVKNGAIVVCRIQVCCMS
cccHHHHHccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccHHHHHHHHHHHHccccccEEEEEEEcccccccccHHHHHHHHcccccHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHcccCEEECccccccccEEEEEEEccccccccccccHHHHcccEEEEEEEcccccccccccccccHHHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHccccccccCEEEcccccccccccccccccccccccccHHHHHccccccccccccccCCccccccccccCEEEEEEECcccccccEEEECccccEEEEEEEEEcccccccccccccCEEEEccccccccccccccccccccccccccEEEEEEEEEcccccccccccccEEEEcccEEEHHHHHHHHHHcccccccccccccccccccEEEEEEEEEEcc
*********************************************************************************HLNVVFIGHVDAGKSTTGGQILFLSGQVDDRTIQKYEKEAKDKSRESWYMAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGFEKGGQTREHVMLAKTLGVTKLLLVVNKMDDHTVNWSKERYDEIESKMTPFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVELLHQIDLKTKKPMKKKVLFVKNGAIVVCRIQVCCM*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIEEDIRSLQLDSAEENNGVVNPGDARPEEVEVVDKMEEDSEEVQAVSQPVHPEPKVKHKEVSAVEDAESQQETEGNNKRHLNVVFIGHVDAGKSTTGGQILFLSGQVDDRTIQKYEKEAKDKSRESWYMAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGFEKGGQTREHVMLAKTLGVTKLLLVVNKMDDHTVNWSKERYDEIESKMTPFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVELLHQIDLKTKKPMKKKVLFVKNGAIVVCRIQVCCMS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Elongation factor 1-alpha This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.probableA3MV69
Elongation factor 1-alpha This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.probableQ979T1
Eukaryotic peptide chain release factor GTP-binding subunit ERF3B Involved in translation termination in response to the termination codons UAA, UAG and UGA. May play a role as a potent stimulator of the release factor activity of ETF1. Exhibits GTPase activity, which is ribosome- and ETF1-dependent. May play a role in cell cycle progression. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.probableQ8IYD1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1R5B, chain A
Confidence level:very confident
Coverage over the Query: 79-123,152-169,181-472
View the alignment between query and template
View the model in PyMOL