Citrus Sinensis ID: 011914

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-----

MAAVVSTVGAVNNALPLKINGSSRFSLVPSSVFLGKSLKKVSSKVSQQRILSKSFKVVSEYDEEKQTSQDRWAGLAYDISDDQQDITRGKGMVDTLFQAPMESGTHYAVMSSYDYISQGLRQYSLDNTLDGLYIAPAFMDKVVVHITKNFLNLPNVKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIIKKGKMCCLFINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNQEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCSGIFRTDNVPKEDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWISEVGIERIGKRLVNSKEGPPTFEQPKMTLDKLLEYGRMLVQEQENVKRVQLADKYLSEAALGDANDDAIKNGSFYGKAAQQVKVPVPEGCTDPAAANYDPTARSDDGSCNYQF

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcHHHHHcccccccccccccccccccccccccccccccccCEEEEccHHHHcccEEEEcccccccccEEccHHHHHHHHHHHHHHHccccccccEEEEEEccccccHHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccEEEccccccccccccccccccccEECcccccccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*********A*NNAL********************************************************WAGLAYDISDDQQDITRGKGMVDTLFQAPMESGTHYAVMSSYDYISQGLRQYSLDNTLDGLYIAPAFMDKVVVHITKNFLNLPNVKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIIKKGKMCCLFINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNQEENPRVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCSGIFRTDNVPKEDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWISEVGIERIGKRLV***************LDKLLEYGRMLVQEQENVKRVQLADKYLSEAALGDA**DAIKNGSFYGKA********************************Y**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic	Activation of RuBisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase; EC 4.1.1.39) involves the ATP-dependent carboxylation of the epsilon-amino group of lysine leading to a carbamate structure.	confident	P93431
Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic	Activation of RuBisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase; EC 4.1.1.39) involves the ATP-dependent carboxylation of the epsilon-amino group of lysine leading to a carbamate structure.	confident	P10896
Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic	Activation of RuBisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase; EC 4.1.1.39) involves the ATP-dependent carboxylation of the epsilon-amino group of lysine leading to a carbamate structure.	probable	O98997

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T15, chain A
Confidence level:very confident
Coverage over the Query: 124-232,247-263,275-416
View the alignment between query and template
View the model in PyMOL