BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 011921
         (475 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2PB0|A Chain A, Structure Of Biosynthetic N-Acetylornithine
           Aminotransferase From Salmonella Typhimurium: Studies On
           Substrate Specificity And Inhibitor Binding
 pdb|2PB0|B Chain B, Structure Of Biosynthetic N-Acetylornithine
           Aminotransferase From Salmonella Typhimurium: Studies On
           Substrate Specificity And Inhibitor Binding
 pdb|2PB2|A Chain A, Structure Of Biosynthetic N-Acetylornithine
           Aminotransferase From Salmonella Typhimurium: Studies On
           Substrate Specificity And Inhibitor Binding
 pdb|2PB2|B Chain B, Structure Of Biosynthetic N-Acetylornithine
           Aminotransferase From Salmonella Typhimurium: Studies On
           Substrate Specificity And Inhibitor Binding
          Length = 420

 Score = 28.5 bits (62), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 46/103 (44%), Gaps = 6/103 (5%)

Query: 10  LINGLSLVAKEITKRSQALQTARTGDVETLISSSLKK-ALVSATEISGLTRGTVREFTNP 68
           +IN   ++    TKR Q +Q  +  D +  I S ++   L+   E+    +G  R+F   
Sbjct: 316 IINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKGRARDFLYA 375

Query: 69  KPKESIVYFNDSSDVAQSAPS-----TDKDGAVDQFAASVRDV 106
             +  ++  N  +DV + APS      D    + +FA +V  V
Sbjct: 376 GAEAGVMVLNAGADVMRFAPSLVVEEADIHEGMQRFAQAVGKV 418


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.132    0.372 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,968,334
Number of Sequences: 62578
Number of extensions: 427241
Number of successful extensions: 1087
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1083
Number of HSP's gapped (non-prelim): 7
length of query: 475
length of database: 14,973,337
effective HSP length: 102
effective length of query: 373
effective length of database: 8,590,381
effective search space: 3204212113
effective search space used: 3204212113
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)