Citrus Sinensis ID: 011952

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470----
MGSLLSRNTSRVGATKPSEALQYETCKRQRLLSSFFDESPRLIPSLPDEISLQILARIPRIYYLNVKLVSRAWKAAITSSELFSFRKELGTTEEWLYILTKVEDDKLSWHALDPLAGRWQRLPPMPSIIFEDELRRGSAAIRMWNVLGSTIKIADLIRGWLGKKDALDRMGFCGCSIGAVDGCLYVLGGFSRALAMRNVWRYDPVLNAWSEVSSMSVGRAYSKIGILNNKLYAVGGVTRGPGGLTPLQSAEVFDPRTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMSSYRGRLFVPQSLYFWPFFVDVGGEVYDPDVNSWVEMPVGMGEGWPVRQAGTKLSITVEGELYALDPSGALDSAKIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGKLHVITNDANHNIAVLQADVKNHFASMPSASSSSFHDCINEPASGSETDTWKMIAIRNAGSAELVSCQTINL
ccccccccccccccccccccccccHHHHHccccccccccccccccccHHHHHHHHHcccccccHHHHHccHHHHHccccccHHHHcccccccccEEEEEEEccccccEEEEEEcccccEEEcccccccccccccEEEEEEEEEEEccccEEEEEcccccEEcccccccccccccEEEEEEccEEEEEccccccccccEEEEEEcccccEEccccccccccccEEEEEccEEEEEccccccccccccccEEEEEEcccccEEEcccccccccccccccccccccccccccEEEEccEEEEEcccccccccccEEEEEEccccccEEEcccccccccccccccccEEEEEccEEEEEcccccccccEEEEEEcccccEEEEcccccccccccccccEEEEEEccEEEEEEccccccEEEEEEEccccccccccccccccccccccccccccccccEEEEEcccccccEEEEEEEEc
cccHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHccccccEEEEEEcccccccEEEEEccccccEEEccccccccEEcccEEEEEEccccccEEEEEEEEcccccccccccccccccccccEEEEEccEEEEEEcccccccccEEEEEccccccEEEcccccccccccEEEEEccEEEEEEEEcccccccccccEEEEEccccccEEEcccccccccccccEEEcHHHcccccEEEEEEccEEEEEccccccccccccEEEEEccccccEEEcccccccccccccccccEEEEEccEEEEEcccccccccEEEEEccccccEEEEcccccccccccccccEEEEEEccEEEEEEccccccccEEEEEEEcccccHHccccccccEEEcccccccccEEEEEEEEcccccEEEEEEEEEEc
mgsllsrntsrvgatkpsealqyETCKRQRLlssffdesprlipslpdeISLQILARIPRIYYLNVKLVSRAWKAAITSSELFSFRKELGTTEEWLYILTKVeddklswhaldplagrwqrlppmpsiifedELRRGSAAIRMWNVLGSTIKIADLIRgwlgkkdaldrmgfcgcsigavdgcLYVLGGFSRALAMRNVWRYDPVLNAWSEvssmsvgrayskigilnnklyavggvtrgpggltplqsaevfdprtglwSEILsmpfskaqvlpTAFLADLLKPiatgmssyrgrlfvpqslyfwpffvdvggevydpdvnswvempvgmgegwpvrqagtklsitvegelyaldpsgaldsakikvydyhddtwkvvvgdvplpnftdsespYLLAGLLGKLHVITNDANHNIAVLQADVknhfasmpsassssfhdcinepasgsetdtWKMIAIRNAGSAELVSCQTINL
mgsllsrntsrvgatkpsealqyetCKRQRLLSSFFDESPRLIPSLPDEISLQILARIPRIYYLNVKLVSRAWKAAITSSELFSFRKELGTTEEWLYILTKVEDDKLSWHALDPlagrwqrlppMPSIIFEDELRRGSAAIRMWNVLGSTIKIADLIRGWLGKKDALDRMGFCGCSIGAVDGCLYVLGGFSRALAMRNVWRYDPVLNAWSEVSSMSVGRAYSKIGILNNKLYAVGGVTRGPGGLTPLQSAEVFDPRTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMSSYRGRLFVPQSLYFWPFFVDVGGEVYDPDVNSWVEMPVGMGEGWPVRQAGTKLSITVEGELYALDPSGALDSAKIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGKLHVITNDANHNIAVLQADVKNHFASMPSASSSSFHDCINEPASGSETDTWKMIAIRNAgsaelvscqtinl
MGSLLSRNTSRVGATKPSEALQYETCKRQRLLSSFFDESPRLIPSLPDEISLQILARIPRIYYLNVKLVSRAWKAAITSSELFSFRKELGTTEEWLYILTKVEDDKLSWHALDPLAGRWQRLPPMPSIIFEDELRRGSAAIRMWNVLGSTIKIADLIRGWLGKKDALDRMGFCGCSIGAVDGCLYVLGGFSRALAMRNVWRYDPVLNAWSEVSSMSVGRAYSKIGILNNKLYAVGGVTRGPGGLTPLQSAEVFDPRTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMSSYRGRLFVPQSLYFWPFFVDVGGEVYDPDVNSWVEMPVGMGEGWPVRQAGTKLSITVEGELYALDPSGALDSAKIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGKLHVITNDANHNIAVLQADVKNHFasmpsassssFHDCINEPASGSETDTWKMIAIRNAGSAELVSCQTINL
*************************CKRQRLLSSFFDESPRLIPSLPDEISLQILARIPRIYYLNVKLVSRAWKAAITSSELFSFRKELGTTEEWLYILTKVEDDKLSWHALDPLAGRWQRLPPMPSIIFEDELRRGSAAIRMWNVLGSTIKIADLIRGWLGKKDALDRMGFCGCSIGAVDGCLYVLGGFSRALAMRNVWRYDPVLNAWSEVSSMSVGRAYSKIGILNNKLYAVGGVTRGPGGLTPLQSAEVFDPRTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMSSYRGRLFVPQSLYFWPFFVDVGGEVYDPDVNSWVEMPVGMGEGWPVRQAGTKLSITVEGELYALDPSGALDSAKIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGKLHVITNDANHNIAVLQADVKNHF*************************TWKMIAIRNAG***L********
********************************************SLPDEISLQILARIPRIYYLNVKLVSRAWKAAITSSELFSFRKELGTTEEWLYILTKVEDDKLSWHALDPLAGRWQRLPPMPSIIFEDELRRGSAAIRMWNVLGSTIKIADLIRGWLGK****DRMGFCGCSIGAVDGCLYVLGGFSRALAMRNVWRYDPVLNAWSEVSSMSVGRAYSKIGILNNKLYAVGGVTRGPGGLTPLQSAEVFDPRTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMSSYRGRLFVPQSLYFWPFFVDVGGEVYDPDVNSWVEMPVGMGEGWPVRQAGTKLSITVEGELYALDPSGALDSAKIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGKLHVITNDANHNIAVLQADVKNHFASMPSASSSSFHDCINEPASGSETDTWKMIAIRNAGSAELVSCQTINL
***************KPSEALQYETCKRQRLLSSFFDESPRLIPSLPDEISLQILARIPRIYYLNVKLVSRAWKAAITSSELFSFRKELGTTEEWLYILTKVEDDKLSWHALDPLAGRWQRLPPMPSIIFEDELRRGSAAIRMWNVLGSTIKIADLIRGWLGKKDALDRMGFCGCSIGAVDGCLYVLGGFSRALAMRNVWRYDPVLNAWSEVSSMSVGRAYSKIGILNNKLYAVGGVTRGPGGLTPLQSAEVFDPRTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMSSYRGRLFVPQSLYFWPFFVDVGGEVYDPDVNSWVEMPVGMGEGWPVRQAGTKLSITVEGELYALDPSGALDSAKIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGKLHVITNDANHNIAVLQADVKNHFAS*********HDCINEPASGSETDTWKMIAIRNAGSAEL********
**************************************SPRLIPSLPDEISLQILARIPRIYYLNVKLVSRAWKAAITSSELFSFRKELGTTEEWLYILTKVEDDKLSWHALDPLAGRWQRLPPMPSIIFEDELRRGSAAIRMWNVLGSTIKIADLIRGWLGKKDALDRMGFCGCSIGAVDGCLYVLGGFSRALAMRNVWRYDPVLNAWSEVSSMSVGRAYSKIGILNNKLYAVGGVTRGPGGLTPLQSAEVFDPRTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMSSYRGRLFVPQSLYFWPFFVDVGGEVYDPDVNSWVEMPVGMGEGWPVRQAGTKLSITVEGELYALDPSGALDSAKIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGKLHVITNDANHNIAVLQADVKNHFASMPSASSSSFHDCINEPASGSETDTWKMIAIRNAGSAELVSCQTINL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSLLSRNTSRVGATKPSEALQYETCKRQRLLSSFFDESPRLIPSLPDEISLQILARIPRIYYLNVKLVSRAWKAAITSSELFSFRKELGTTEEWLYILTKVEDDKLSWHALDPLAGRWQRLPPMPSIIFEDELRRGSAAIRMWNVLGSTIKIADLIRGWLGKKDALDRMGFCGCSIGAVDGCLYVLGGFSRALAMRNVWRYDPVLNAWSEVSSMSVGRAYSKIGILNNKLYAVGGVTRGPGGLTPLQSAEVFDPRTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMSSYRGRLFVPQSLYFWPFFVDVGGEVYDPDVNSWVEMPVGMGEGWPVRQAGTKLSITVEGELYALDPSGALDSAKIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGKLHVITNDANHNIAVLQADVKNHFASMPSASSSSFHDCINEPASGSETDTWKMIAIRNAGSAELVSCQTINL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query474 2.2.26 [Sep-21-2011]
Q9LM55475 F-box/kelch-repeat protei yes no 0.993 0.991 0.608 1e-161
Q93W93434 F-box/kelch-repeat protei no no 0.744 0.813 0.298 2e-33
Q9C6Z0398 F-box/kelch-repeat protei no no 0.599 0.713 0.270 6e-26
Q8LAW2372 F-box protein AFR OS=Arab no no 0.590 0.752 0.277 3e-24
Q9CAG8376 F-box/kelch-repeat protei no no 0.672 0.848 0.262 3e-23
Q9M1W7352 F-box/kelch-repeat protei no no 0.415 0.559 0.294 4e-18
Q9SJ04372 F-box/kelch-repeat protei no no 0.637 0.811 0.255 2e-17
Q0WW40383 F-box/kelch-repeat protei no no 0.624 0.772 0.251 3e-17
Q9M2C9358 F-box/kelch-repeat protei no no 0.506 0.670 0.256 1e-16
Q9SVA0375 F-box/kelch-repeat protei no no 0.573 0.725 0.263 2e-14
>sp|Q9LM55|FBK8_ARATH F-box/kelch-repeat protein At1g22040 OS=Arabidopsis thaliana GN=At1g22040 PE=2 SV=1 Back     alignment and function desciption
 Score =  570 bits (1468), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 291/478 (60%), Positives = 373/478 (78%), Gaps = 7/478 (1%)

Query: 1   MGSLLSRNTSRVGATKPSEALQYETCKRQRLLS-SFFDESPRLIPSLPDEISLQILARIP 59
           MGS++S + S+  AT        E+ KR+++ S +  +E  RLIPSLPDE+S+QILAR+P
Sbjct: 1   MGSVMSLSCSKRKATSQDVECSSESRKRRKISSENDEEECCRLIPSLPDELSIQILARLP 60

Query: 60  RIYYLNVKLVSRAWKAAITSSELFSFRKELGTTEEWLYILTKVEDDKLSWHALDPLAGRW 119
           RI Y +V+LVSR W++A+++SE++S RKELG TEEWLY+LTK  +DKL W+ALDP++ +W
Sbjct: 61  RICYSSVRLVSRRWRSAVSTSEVYSLRKELGRTEEWLYVLTKGHEDKLLWYALDPVSTKW 120

Query: 120 QRLPPMPSIIFEDELRRGSAAIRMWNVLGSTIKIADLIRGWLGKKDALDRMGFCGCSIGA 179
           QRLPPMP +++E+E R+  +   +WN++  +  +  ++R +LG++D+ ++M FCGC+IGA
Sbjct: 121 QRLPPMPVVVYEEESRKSLSG--LWNMITPSFNVGAIVRSFLGRRDSSEQMPFCGCAIGA 178

Query: 180 VDGCLYVLGGFSRALAMRNVWRYDPVLNAWSEVSSMSVGRAYSKIGILNNKLYAVGGVTR 239
           VDG LYV+GG SR+  +  VWR+DP+LN+WSEVSSM   RAYSK G+LN KLY VGGV R
Sbjct: 179 VDGGLYVIGGLSRSKTVSCVWRFDPILNSWSEVSSMLASRAYSKTGVLNKKLYVVGGVDR 238

Query: 240 GPGGLTPLQSAEVFDPRTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMSSYRGRLFV 299
           G GGL+PLQSAEV+DP T  WSE+ SMPFSKAQVLP AFLADLLKPIATGM+ Y GRL V
Sbjct: 239 GRGGLSPLQSAEVYDPSTDAWSEVPSMPFSKAQVLPNAFLADLLKPIATGMTCYNGRLCV 298

Query: 300 PQSLYFWPFFVDVGGEVYDPDVNSWVEMPVGMGEGWPVRQAGTKLSITVEGELYALDPSG 359
           PQSLY WPFFVDVGGEVYDP+ N WVEMP GMGEGWP RQAGTKLS+ V+GELYA DPS 
Sbjct: 299 PQSLYSWPFFVDVGGEVYDPETNLWVEMPSGMGEGWPARQAGTKLSVVVDGELYAFDPSS 358

Query: 360 ALDSAKIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGKLHVITNDANHNIAVLQ 419
           ++++ KIKVYD  +DTWKVV+G+VP+ + TDSESPYLLAG  GKLH IT D NHN+ VL+
Sbjct: 359 SMENGKIKVYDQKEDTWKVVIGEVPVYDLTDSESPYLLAGFHGKLHFITRDPNHNVTVLR 418

Query: 420 ADVKNHFASMPSASSSSF---HDCINEPASGSETDTWKMIAIRNAGSAELVSCQTINL 474
           ADV N   S  S+SSSS    H   N P + S+T TWK+IA ++ G+AELVSCQ I++
Sbjct: 419 ADVPNIPVSSSSSSSSSVSIPHLKTNAP-NKSDTVTWKLIATKDFGAAELVSCQVIDI 475

Arabidopsis thaliana (taxid: 3702)
>sp|Q93W93|FBK22_ARATH F-box/kelch-repeat protein At1g55270 OS=Arabidopsis thaliana GN=At1g55270 PE=2 SV=1 Back     alignment and function description
>sp|Q9C6Z0|FBK17_ARATH F-box/kelch-repeat protein At1g30090 OS=Arabidopsis thaliana GN=At1g30090 PE=2 SV=1 Back     alignment and function description
>sp|Q8LAW2|AFR_ARATH F-box protein AFR OS=Arabidopsis thaliana GN=AFR PE=1 SV=2 Back     alignment and function description
>sp|Q9CAG8|FBK28_ARATH F-box/kelch-repeat protein At1g67480 OS=Arabidopsis thaliana GN=At1g67480 PE=2 SV=1 Back     alignment and function description
>sp|Q9M1W7|SKI30_ARATH F-box/kelch-repeat protein SKIP30 OS=Arabidopsis thaliana GN=SKIP30 PE=1 SV=2 Back     alignment and function description
>sp|Q9SJ04|SKIP6_ARATH F-box/kelch-repeat protein SKIP6 OS=Arabidopsis thaliana GN=SKIP6 PE=1 SV=1 Back     alignment and function description
>sp|Q0WW40|FBK5_ARATH F-box/kelch-repeat protein At1g16250 OS=Arabidopsis thaliana GN=At1g16250 PE=2 SV=1 Back     alignment and function description
>sp|Q9M2C9|SKIP4_ARATH F-box/kelch-repeat protein SKIP4 OS=Arabidopsis thaliana GN=SKIP4 PE=1 SV=1 Back     alignment and function description
>sp|Q9SVA0|FK101_ARATH F-box/kelch-repeat protein At4g39580 OS=Arabidopsis thaliana GN=At4g39580 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query474
449438171479 PREDICTED: F-box/kelch-repeat protein At 0.991 0.981 0.668 0.0
357445771476 F-box/kelch-repeat protein [Medicago tru 0.997 0.993 0.693 0.0
225459394477 PREDICTED: F-box/kelch-repeat protein At 0.997 0.991 0.677 0.0
356524860481 PREDICTED: F-box/kelch-repeat protein At 1.0 0.985 0.679 0.0
225447858479 PREDICTED: F-box/kelch-repeat protein At 1.0 0.989 0.686 0.0
356512083481 PREDICTED: F-box/kelch-repeat protein At 0.997 0.983 0.676 0.0
147810973499 hypothetical protein VITISV_011508 [Viti 0.987 0.937 0.680 0.0
427199304473 F-box family protein [Morella rubra] 0.993 0.995 0.626 1e-179
224082190474 f-box family protein [Populus trichocarp 0.997 0.997 0.629 1e-177
255587389469 conserved hypothetical protein [Ricinus 0.983 0.993 0.683 1e-175
>gi|449438171|ref|XP_004136863.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Cucumis sativus] gi|449478907|ref|XP_004155450.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/479 (66%), Positives = 387/479 (80%), Gaps = 9/479 (1%)

Query: 1   MGSLLSRNTSRVGATKPSEALQYETCKRQRLLSSFFDESPRLIPSLPDEISLQILARIPR 60
           MG+ LS N     A  P E +  E CK+Q+L+S++++E+ RLI SLPDEIS+QILAR+PR
Sbjct: 1   MGAKLSLNIFGARADGPDEFVPVEACKKQKLMSNYWEENQRLISSLPDEISIQILARVPR 60

Query: 61  IYYLNVKLVSRAWKAAITSSELFSFRKELGTTEEWLYILTKVEDDKLSWHALDPLAGRWQ 120
           I+YL +K+VSRAWK AITS++LF  R+ELGT EEWLYILTKV+D KL W+A+DP A RWQ
Sbjct: 61  IHYLRLKMVSRAWKHAITSNQLFHLRQELGTAEEWLYILTKVKDGKLVWYAMDPQARRWQ 120

Query: 121 RLPPMPSIIFEDELRRGSAAIRMWNVLGSTIKIADLIRGWLGKKDALDRMGFCGCSIGAV 180
           +LPPMP+I  EDE ++G    R+WN+ GS+++IAD I  WLG+KDALD+M FCGC++GA+
Sbjct: 121 KLPPMPTISLEDETKKGLTGQRIWNMAGSSMRIADAIMAWLGRKDALDQMPFCGCAVGAI 180

Query: 181 DGCLYVLGGFSRALAMRNVWRYDPVLNAWSEVSSMSVGRAYSKIGILNNKLYAVGGVTRG 240
           DGCLYVLGGFS A AMR VWRYDPV N W+E  SMS+GRAY K  +LNNKLY VGGVTRG
Sbjct: 181 DGCLYVLGGFSSASAMRCVWRYDPVANTWNEAHSMSIGRAYCKTTVLNNKLYVVGGVTRG 240

Query: 241 PGGLTPLQSAEVFDPRTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMSSYRGRLFVP 300
            GGL+PLQSAEV+DP TG+WSE+ SMPF+KAQVLPTAFLADLLKPIATG++SY+G+LFVP
Sbjct: 241 NGGLSPLQSAEVYDPNTGMWSEMPSMPFAKAQVLPTAFLADLLKPIATGLTSYQGKLFVP 300

Query: 301 QSLYFWPFFVDVGGEVYDPDVNSWVEMPVGMGEGWPVRQAGTKLSITVEGELYALDPSGA 360
           QSLY WPFFVDVGGEVYDPDVN+WVEMP+GMGEGWP RQAGTKLS+TV GELYALDPS +
Sbjct: 301 QSLYCWPFFVDVGGEVYDPDVNTWVEMPMGMGEGWPARQAGTKLSVTVNGELYALDPSSS 360

Query: 361 LDSAKIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGKLHVITNDANHNIAVLQA 420
           LD+AK+KVYD H D WKVV  D+P+ +F+DSESPYLLAGL  KLHVIT DAN+NI V+QA
Sbjct: 361 LDNAKVKVYDSHSDAWKVVAEDIPIHDFSDSESPYLLAGLTQKLHVITKDANNNITVMQA 420

Query: 421 DVKNHFASMPSASSS-------SFHDCINEPASGSETDTWKMIAIRNAGSAELVSCQTI 472
            V+NH  +   ++SS        F + + E    SE  T K+IA R  GSAELVSCQT+
Sbjct: 421 GVRNHHLASFQSASSSSSSQDICFRE-LQELDEESENFT-KVIATRTVGSAELVSCQTL 477

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357445771|ref|XP_003593163.1| F-box/kelch-repeat protein [Medicago truncatula] gi|355482211|gb|AES63414.1| F-box/kelch-repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|225459394|ref|XP_002285816.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356524860|ref|XP_003531046.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Glycine max] Back     alignment and taxonomy information
>gi|225447858|ref|XP_002271882.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356512083|ref|XP_003524750.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Glycine max] Back     alignment and taxonomy information
>gi|147810973|emb|CAN63480.1| hypothetical protein VITISV_011508 [Vitis vinifera] Back     alignment and taxonomy information
>gi|427199304|gb|AFY26883.1| F-box family protein [Morella rubra] Back     alignment and taxonomy information
>gi|224082190|ref|XP_002306596.1| f-box family protein [Populus trichocarpa] gi|222856045|gb|EEE93592.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255587389|ref|XP_002534256.1| conserved hypothetical protein [Ricinus communis] gi|223525632|gb|EEF28126.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query474
TAIR|locus:2030601475 AT1G22040 "AT1G22040" [Arabido 0.991 0.989 0.599 4.9e-156
TAIR|locus:2035696434 AT1G55270 "AT1G55270" [Arabido 0.453 0.495 0.294 3e-33
TAIR|locus:2046683372 AFR "ATTENUATED FAR-RED RESPON 0.295 0.376 0.316 5.6e-09
TAIR|locus:2077299352 AT3G63220 "AT3G63220" [Arabido 0.200 0.269 0.375 4e-17
TAIR|locus:2008773376 AT1G67480 "AT1G67480" [Arabido 0.464 0.585 0.305 5.9e-17
TAIR|locus:2032855383 AT1G16250 "AT1G16250" [Arabido 0.168 0.208 0.341 9.7e-16
TAIR|locus:2098926358 SKIP4 "AT3G61350" [Arabidopsis 0.447 0.592 0.255 1.4e-15
TAIR|locus:2139722396 AT4G11770 "AT4G11770" [Arabido 0.455 0.545 0.283 4.7e-13
TAIR|locus:2056705467 AT2G02870 "AT2G02870" [Arabido 0.476 0.483 0.257 9.8e-13
TAIR|locus:2012547441 AT1G14330 "AT1G14330" [Arabido 0.478 0.514 0.243 1.9e-12
TAIR|locus:2030601 AT1G22040 "AT1G22040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1521 (540.5 bits), Expect = 4.9e-156, P = 4.9e-156
 Identities = 287/479 (59%), Positives = 366/479 (76%)

Query:     1 MGSLLSRNTSRVGATKPSEALQYETCKRQRLLSSFFDESP--RLIPSLPDEISLQILARI 58
             MGS++S + S+  AT        E+ KR+++ SS  DE    RLIPSLPDE+S+QILAR+
Sbjct:     1 MGSVMSLSCSKRKATSQDVECSSESRKRRKI-SSENDEEECCRLIPSLPDELSIQILARL 59

Query:    59 PRIYYLNVKLVSRAWKAAITSSELFSFRKELGTTEEWLYILTKVEDDKLSWHALDPLAGR 118
             PRI Y +V+LVSR W++A+++SE++S RKELG TEEWLY+LTK  +DKL W+ALDP++ +
Sbjct:    60 PRICYSSVRLVSRRWRSAVSTSEVYSLRKELGRTEEWLYVLTKGHEDKLLWYALDPVSTK 119

Query:   119 WQRLPPMPSIIFEDELRRGSAAIRMWNVLGSTIKIADLIRGWLGKKDALDRMGFCGCSIG 178
             WQRLPPMP +++E+E R+  + +  WN++  +  +  ++R +LG++D+ ++M FCGC+IG
Sbjct:   120 WQRLPPMPVVVYEEESRKSLSGL--WNMITPSFNVGAIVRSFLGRRDSSEQMPFCGCAIG 177

Query:   179 AVDGCLYVLGGFSRALAMRNVWRYDPVLNAWSEVSSMSVGRAYSKIGILNNKLYAVGGVT 238
             AVDG LYV+GG SR+  +  VWR+DP+LN+WSEVSSM   RAYSK G+LN KLY VGGV 
Sbjct:   178 AVDGGLYVIGGLSRSKTVSCVWRFDPILNSWSEVSSMLASRAYSKTGVLNKKLYVVGGVD 237

Query:   239 RGPGGLTPLQSAEVFDPRTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMSSYRGRLF 298
             RG GGL+PLQSAEV+DP T  WSE+ SMPFSKAQVLP AFLADLLKPIATGM+ Y GRL 
Sbjct:   238 RGRGGLSPLQSAEVYDPSTDAWSEVPSMPFSKAQVLPNAFLADLLKPIATGMTCYNGRLC 297

Query:   299 VPQSLYFWPFFVDVGGEVYDPDVNSWVEMPVGMGEGWPVRQAGTKLSITVEGELYALDPS 358
             VPQSLY WPFFVDVGGEVYDP+ N WVEMP GMGEGWP RQAGTKLS+ V+GELYA DPS
Sbjct:   298 VPQSLYSWPFFVDVGGEVYDPETNLWVEMPSGMGEGWPARQAGTKLSVVVDGELYAFDPS 357

Query:   359 GALDSAKIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGKLHVITNDANHNIAVL 418
              ++++ KIKVYD  +DTWKVV+G+VP+ + TDSESPYLLAG  GKLH IT D NHN+ VL
Sbjct:   358 SSMENGKIKVYDQKEDTWKVVIGEVPVYDLTDSESPYLLAGFHGKLHFITRDPNHNVTVL 417

Query:   419 QADVKNHFXXXXXXXXXXF---HDCINEPASGSETDTWKMIAIRNAGSAELVSCQTINL 474
             +ADV N                H   N P + S+T TWK+IA ++ G+AELVSCQ I++
Sbjct:   418 RADVPNIPVSSSSSSSSSVSIPHLKTNAP-NKSDTVTWKLIATKDFGAAELVSCQVIDI 475
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
TAIR|locus:2035696 AT1G55270 "AT1G55270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046683 AFR "ATTENUATED FAR-RED RESPONSE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077299 AT3G63220 "AT3G63220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008773 AT1G67480 "AT1G67480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032855 AT1G16250 "AT1G16250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098926 SKIP4 "AT3G61350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139722 AT4G11770 "AT4G11770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056705 AT2G02870 "AT2G02870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012547 AT1G14330 "AT1G14330" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LM55FBK8_ARATHNo assigned EC number0.60870.99360.9915yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00015284001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (477 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query474
smart0061247 smart00612, Kelch, Kelch domain 2e-10
pfam0134446 pfam01344, Kelch_1, Kelch motif 2e-10
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 6e-09
pfam0064648 pfam00646, F-box, F-box domain 9e-07
pfam0134446 pfam01344, Kelch_1, Kelch motif 1e-06
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 2e-06
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 3e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 9e-06
pfam1293747 pfam12937, F-box-like, F-box-like 1e-04
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-04
smart0061247 smart00612, Kelch, Kelch domain 3e-04
pfam1396450 pfam13964, Kelch_6, Kelch motif 0.003
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 0.003
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information 
 Score = 55.6 bits (135), Expect = 2e-10
 Identities = 15/47 (31%), Positives = 26/47 (55%)

Query: 183 CLYVLGGFSRALAMRNVWRYDPVLNAWSEVSSMSVGRAYSKIGILNN 229
            +YV+GGF     +++V  YDP  N W+ + SM   R+   + ++N 
Sbjct: 1   KIYVVGGFDGGQRLKSVEVYDPETNKWTPLPSMPTPRSGHGVAVING 47

Length = 47
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 474
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02153341 epithiospecifier protein 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.97
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.95
KOG0379482 consensus Kelch repeat-containing proteins [Genera 99.94
KOG1230 521 consensus Protein containing repeated kelch motifs 99.93
KOG1230521 consensus Protein containing repeated kelch motifs 99.93
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.91
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.91
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.75
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.49
PF1396450 Kelch_6: Kelch motif 99.34
PF1396450 Kelch_6: Kelch motif 99.24
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.22
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.12
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.08
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.07
PF1341549 Kelch_3: Galactose oxidase, central domain 99.01
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.93
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.91
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.89
smart0061247 Kelch Kelch domain. 98.84
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.81
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.73
PF1341549 Kelch_3: Galactose oxidase, central domain 98.7
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.63
smart0061247 Kelch Kelch domain. 98.63
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.53
PLN02772398 guanylate kinase 98.52
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.47
PF1385442 Kelch_5: Kelch motif 98.37
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 98.37
PF1385442 Kelch_5: Kelch motif 98.34
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.26
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.23
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.14
PLN02772 398 guanylate kinase 98.14
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.96
KOG0281499 consensus Beta-TrCP (transducin repeats containing 97.78
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.42
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.16
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.04
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.01
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 96.95
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.82
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 96.57
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.45
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.43
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.18
PF12768281 Rax2: Cortical protein marker for cell polarity 95.92
PF12768281 Rax2: Cortical protein marker for cell polarity 95.78
KOG2997366 consensus F-box protein FBX9 [General function pre 95.77
PF09910339 DUF2139: Uncharacterized protein conserved in arch 95.75
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 95.7
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.2
PF03089337 RAG2: Recombination activating protein 2; InterPro 94.93
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 94.77
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.75
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 93.59
smart00284255 OLF Olfactomedin-like domains. 93.5
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 93.1
PRK13684334 Ycf48-like protein; Provisional 93.07
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 92.82
KOG0310 487 consensus Conserved WD40 repeat-containing protein 92.75
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 92.62
KOG2055514 consensus WD40 repeat protein [General function pr 92.02
PRK04922433 tolB translocation protein TolB; Provisional 91.84
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 91.81
PRK13684334 Ycf48-like protein; Provisional 91.65
PRK00178430 tolB translocation protein TolB; Provisional 91.6
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 91.36
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 91.34
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 91.02
KOG2055514 consensus WD40 repeat protein [General function pr 90.89
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 90.77
PRK00178430 tolB translocation protein TolB; Provisional 90.73
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 90.51
PRK05137435 tolB translocation protein TolB; Provisional 90.21
PTZ00421 493 coronin; Provisional 90.03
smart00284255 OLF Olfactomedin-like domains. 89.9
PRK04792448 tolB translocation protein TolB; Provisional 89.48
PRK04792448 tolB translocation protein TolB; Provisional 88.55
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 88.16
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 88.01
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 87.91
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 87.49
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 87.32
KOG0316307 consensus Conserved WD40 repeat-containing protein 87.32
PRK04043419 tolB translocation protein TolB; Provisional 87.3
PRK11028330 6-phosphogluconolactonase; Provisional 87.27
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 86.94
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 85.85
PLN029191057 haloacid dehalogenase-like hydrolase family protei 85.06
PRK04922433 tolB translocation protein TolB; Provisional 84.53
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 84.41
PRK04043419 tolB translocation protein TolB; Provisional 82.94
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 82.71
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 82.44
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 80.64
PRK11028330 6-phosphogluconolactonase; Provisional 80.54
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=5.5e-43  Score=360.86  Aligned_cols=316  Identities=27%  Similarity=0.464  Sum_probs=250.5

Q ss_pred             CCCCcHHHHHHhhhccCccc-hhhH-HHh--hHHHHHhhcCch-hhhhhhhcC-CCccEEEEEEeecC-C--ceeEEEeC
Q 011952           43 IPSLPDEISLQILARIPRIY-YLNV-KLV--SRAWKAAITSSE-LFSFRKELG-TTEEWLYILTKVED-D--KLSWHALD  113 (474)
Q Consensus        43 ~~~LPddl~~~il~rlp~~~-~~~~-~~V--ck~W~~li~s~~-~~~~r~~~~-~~~~~l~v~gg~~~-~--~~~~~~yd  113 (474)
                      +|-||...+.++....+... -..+ ..+  .+.|..+-.... ....|.... ...+.||++||..+ .  ...+..||
T Consensus       228 ~~ll~~~~l~~~v~~~~~~~~~~~c~~~l~ea~~~~~~~~~~~~~~~~~t~~r~~~~~~l~~vGG~~~~~~~~~~ve~yd  307 (571)
T KOG4441|consen  228 LPLLPPQFLVEIVESEPLIKRDSACRDLLDEAKKYHLLPQRRPVMQSPRTRPRRSVSGKLVAVGGYNRQGQSLRSVECYD  307 (571)
T ss_pred             ccCCCHHHHHHHHhhhhhhccCHHHHHHHHHHHHHhhCcccCccccCCCcccCcCCCCeEEEECCCCCCCcccceeEEec
Confidence            47888877777777665110 0011 111  123333322111 222333333 45678999999875 2  23788999


Q ss_pred             CCCCceeeCCCCCCccchhhhhccceeEeeeeeeccceeeeeeeccccccccccCCCCccceeEEEeCCEEEEEcCcC-C
Q 011952          114 PLAGRWQRLPPMPSIIFEDELRRGSAAIRMWNVLGSTIKIADLIRGWLGKKDALDRMGFCGCSIGAVDGCLYVLGGFS-R  192 (474)
Q Consensus       114 ~~~~~W~~l~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~p~pr~~~~~~~~~~~lyv~GG~~-~  192 (474)
                      |.+++|..+++||.+                                           |..+++++++|+||++||.+ +
T Consensus       308 ~~~~~w~~~a~m~~~-------------------------------------------r~~~~~~~~~~~lYv~GG~~~~  344 (571)
T KOG4441|consen  308 PKTNEWSSLAPMPSP-------------------------------------------RCRVGVAVLNGKLYVVGGYDSG  344 (571)
T ss_pred             CCcCcEeecCCCCcc-------------------------------------------cccccEEEECCEEEEEccccCC
Confidence            999999999999975                                           88899999999999999999 6


Q ss_pred             CcccceEEEEeCCCCceeecCCCCCCcceeeEEEECCEEEEEeceecCCCCCccCceEEEEeCCCCceEEccCCCccccc
Q 011952          193 ALAMRNVWRYDPVLNAWSEVSSMSVGRAYSKIGILNNKLYAVGGVTRGPGGLTPLQSAEVFDPRTGLWSEILSMPFSKAQ  272 (474)
Q Consensus       193 ~~~~~~v~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~~~~yd~~t~~W~~~~~~p~~r~~  272 (474)
                      ...++++++|||.+++|..+++|+.+|..+++++++|+||++||.+    +...++++|+|||.+++|+.+++|+.+|++
T Consensus       345 ~~~l~~ve~YD~~~~~W~~~a~M~~~R~~~~v~~l~g~iYavGG~d----g~~~l~svE~YDp~~~~W~~va~m~~~r~~  420 (571)
T KOG4441|consen  345 SDRLSSVERYDPRTNQWTPVAPMNTKRSDFGVAVLDGKLYAVGGFD----GEKSLNSVECYDPVTNKWTPVAPMLTRRSG  420 (571)
T ss_pred             CcccceEEEecCCCCceeccCCccCccccceeEEECCEEEEEeccc----cccccccEEEecCCCCcccccCCCCcceee
Confidence            7889999999999999999999999999999999999999999987    667799999999999999999999999998


Q ss_pred             cccchhhccccccceeeEEEeCCEEEEeccCCCCc-ceeccceEEEcCCCCceEEcCCCCCCCCCccccCcceEEEECCE
Q 011952          273 VLPTAFLADLLKPIATGMSSYRGRLFVPQSLYFWP-FFVDVGGEVYDPDVNSWVEMPVGMGEGWPVRQAGTKLSITVEGE  351 (474)
Q Consensus       273 ~~~~~~~~~~~~~~~~~~~~~~~~iyv~gG~~~~~-~~~~~gg~~yd~~t~~W~~~~~~~~~~~p~~~~~~~~~~~~~~~  351 (474)
                                     +++++++|+||++||.++.. .+..+  ++|||.+++|+.+++ |.    .+|.+++ +++++++
T Consensus       421 ---------------~gv~~~~g~iYi~GG~~~~~~~l~sv--e~YDP~t~~W~~~~~-M~----~~R~~~g-~a~~~~~  477 (571)
T KOG4441|consen  421 ---------------HGVAVLGGKLYIIGGGDGSSNCLNSV--ECYDPETNTWTLIAP-MN----TRRSGFG-VAVLNGK  477 (571)
T ss_pred             ---------------eEEEEECCEEEEEcCcCCCccccceE--EEEcCCCCceeecCC-cc----cccccce-EEEECCE
Confidence                           99999999999999998877 45444  999999999999998 64    3555555 8999999


Q ss_pred             EEEEcCCCCC-CCceEEEEECCCCceEEeccCCCCCCCCCCCCCeEEEeeCCEEEEEecCCCCceeEEEEeecCCCCCCC
Q 011952          352 LYALDPSGAL-DSAKIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGKLHVITNDANHNIAVLQADVKNHFASMP  430 (474)
Q Consensus       352 lyv~GG~~~~-~~~~v~~yd~~~~~W~~v~~~~p~~~~~~~r~~~~~~~~~~~l~v~GG~~~~~~~~~~~d~~~~~~~~w  430 (474)
                      ||++||.+.. ....+++|||++++|+.+.      .+..+|...++++++++||++||..+ ...+..++.        
T Consensus       478 iYvvGG~~~~~~~~~VE~ydp~~~~W~~v~------~m~~~rs~~g~~~~~~~ly~vGG~~~-~~~l~~ve~--------  542 (571)
T KOG4441|consen  478 IYVVGGFDGTSALSSVERYDPETNQWTMVA------PMTSPRSAVGVVVLGGKLYAVGGFDG-NNNLNTVEC--------  542 (571)
T ss_pred             EEEECCccCCCccceEEEEcCCCCceeEcc------cCccccccccEEEECCEEEEEecccC-ccccceeEE--------
Confidence            9999998652 2457999999999999985      56677888999999999999999443 333444444        


Q ss_pred             CCCCCCCccccCCCCCCcccceeeeeec
Q 011952          431 SASSSSFHDCINEPASGSETDTWKMIAI  458 (474)
Q Consensus       431 ~~~~~~~~~~~~~~~~~~~~~~W~~~~~  458 (474)
                                     ||+++++|+.++.
T Consensus       543 ---------------ydp~~d~W~~~~~  555 (571)
T KOG4441|consen  543 ---------------YDPETDTWTEVTE  555 (571)
T ss_pred             ---------------cCCCCCceeeCCC
Confidence                           4666677777766

>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query474
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 9e-11
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 1e-09
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 1e-09
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 2e-09
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 2e-09
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 1e-08
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 3e-08
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 2e-05
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 2e-04
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure 
Iteration: 1

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 70/159 (44%), Gaps = 22/159 (13%)
Query: 174 GCSIGAVDGCLYVLGGFSRALAMRNVWRYDPVLNAWSEVSSMSVGRAYSKIGILNNKLYA 233
           G  +    G +Y LGG+     + +V +YDP    W+ V+ M+  R+ + + +LN+ +Y 
Sbjct: 152 GAGLVVASGVIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYV 211
Query: 234 VGGVTRGPGGLTPLQSAEVFDPRTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMSSY 293
           VGG      G   L S E ++ RT  W+ + SM   +  V               G +  
Sbjct: 212 VGGFD----GTAHLSSVEAYNIRTDSWTTVTSMTTPRCYV---------------GATVL 252
Query: 294 RGRLFVPQSLYFWPFFVDVGGEVYDPDVNSWVEMPVGMG 332
           RGRL+             +  E YDP ++SW E+   MG
Sbjct: 253 RGRLYAIAGYDGNSLLSSI--ECYDPIIDSW-EVVTSMG 288
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query474
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-34
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 5e-28
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-34
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-27
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-24
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-22
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-12
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-34
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-28
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-24
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-11
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-31
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 4e-28
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-23
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-23
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 8e-31
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 3e-30
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-26
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 5e-23
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 9e-19
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 3e-30
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 7e-27
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-23
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-19
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-16
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-14
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 8e-11
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 1e-05
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 6e-11
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 7e-08
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 9e-08
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
 Score =  130 bits (330), Expect = 1e-34
 Identities = 62/310 (20%), Positives = 102/310 (32%), Gaps = 85/310 (27%)

Query: 110 HALDPLAGRWQRLPPMPS------------IIF----EDELRRGSAAIR---MWNVLGST 150
            A +P  G W RL  +              +++     +    G+        +N + + 
Sbjct: 42  EAYNPSNGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQ 101

Query: 151 -IKIADLIRGWLGKKDALDRMGFCGCSIGAVDGCLYVLGGFSRALAMRNVWRYDPVLNAW 209
               A +            R          +DG +Y +GG    +   +V RY+P  + W
Sbjct: 102 WSPCAPMSVP---------RNRIGVG---VIDGHIYAVGGSHGCIHHNSVERYEPERDEW 149

Query: 210 SEVSSMSVGRAYSKIGILNNKLYAVGGVTRGPGGLTPLQSAEVFDPRTGLWSEILSMPFS 269
             V+ M   R    + +LN  LYAVGG      G   L SAE + P    W  I +M   
Sbjct: 150 HLVAPMLTRRIGVGVAVLNRLLYAVGGFD----GTNRLNSAECYYPERNEWRMITAMNTI 205

Query: 270 KAQVLPTAFLADLLKPIATGMSSYRGRLFVPQSLYFWPFFVDVGG----------EVYDP 319
           ++                 G+      ++              GG          E YD 
Sbjct: 206 RSGA---------------GVCVLHNCIYA------------AGGYDGQDQLNSVERYDV 238

Query: 320 DVNSWVEMPVGMGEGWPVRQAGTKLSITVEGELYAL---DPSGALDSAKIKVYDYHDDTW 376
           +  +W  +   M      R++   ++   +G +Y L   D    LDS  ++ YD   DTW
Sbjct: 239 ETETWTFVAP-M----KHRRSALGIT-VHQGRIYVLGGYDGHTFLDS--VECYDPDTDTW 290

Query: 377 KVVVGDVPLP 386
              V  +   
Sbjct: 291 S-EVTRMTSG 299
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query474
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.97
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.97
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.96
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.76
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.74
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.72
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.63
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.6
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.12
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.01
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.93
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.67
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.6
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.6
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.39
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.27
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.12
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.02
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.01
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.93
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.59
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.53
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 96.53
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.44
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.4
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.38
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.29
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.28
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.25
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.12
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 96.08
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.08
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.96
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.94
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 95.92
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 95.89
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 95.87
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 95.74
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 95.73
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 95.7
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 95.69
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.69
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 95.63
3jrp_A379 Fusion protein of protein transport protein SEC13 95.61
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.61
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 95.52
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 95.51
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 95.5
3jrp_A379 Fusion protein of protein transport protein SEC13 95.46
4a2l_A795 BT_4663, two-component system sensor histidine kin 95.45
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 95.41
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 95.4
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.26
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.26
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 95.15
1itv_A195 MMP9; adaptive molecular recognition, beta propell 95.15
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 95.09
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 95.03
3ow8_A321 WD repeat-containing protein 61; structural genomi 95.0
3v9f_A 781 Two-component system sensor histidine kinase/RESP 94.83
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 94.78
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 94.77
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 94.75
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 94.69
4a2l_A 795 BT_4663, two-component system sensor histidine kin 94.66
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 94.63
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 94.6
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 94.53
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 94.34
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 94.3
3ow8_A321 WD repeat-containing protein 61; structural genomi 94.24
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 94.23
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 94.2
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.19
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 94.17
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 94.11
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 93.94
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 93.88
3jro_A 753 Fusion protein of protein transport protein SEC13 93.66
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 93.59
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 93.53
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 93.42
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 93.39
2fp8_A322 Strictosidine synthase; six bladed beta propeller 93.36
3jro_A 753 Fusion protein of protein transport protein SEC13 93.32
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 93.32
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 93.25
4e54_B435 DNA damage-binding protein 2; beta barrel, double 93.25
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 93.18
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 93.05
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 92.99
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 92.96
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 92.88
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 92.83
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.65
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 92.57
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 92.45
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 92.4
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 92.3
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 92.27
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 92.23
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 92.07
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 91.99
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 91.99
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 91.9
2pm7_B297 Protein transport protein SEC13, protein transport 91.79
3ott_A758 Two-component system sensor histidine kinase; beta 91.76
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 91.64
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 91.55
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 91.53
4g56_B357 MGC81050 protein; protein arginine methyltransfera 91.13
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 91.12
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 91.11
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 91.07
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 91.07
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 91.04
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 91.03
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 90.92
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 90.89
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 90.78
1itv_A195 MMP9; adaptive molecular recognition, beta propell 90.74
3v65_B386 Low-density lipoprotein receptor-related protein; 90.65
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 90.62
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 90.5
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 90.49
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 90.38
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 90.38
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 90.34
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 90.21
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 90.12
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 90.04
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 89.98
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 89.8
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 89.64
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 89.39
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 89.37
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 89.26
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 89.15
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 89.04
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 88.98
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 88.66
3ott_A 758 Two-component system sensor histidine kinase; beta 88.62
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 88.48
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 88.4
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 88.36
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 88.27
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 88.27
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 88.19
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 88.13
3p5b_L400 Low density lipoprotein receptor variant; B-propel 88.12
4g56_B357 MGC81050 protein; protein arginine methyltransfera 87.94
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 87.69
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 87.69
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 87.57
2fp8_A322 Strictosidine synthase; six bladed beta propeller 87.44
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 87.34
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 87.21
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 87.21
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 87.04
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 87.02
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 86.92
2p4o_A306 Hypothetical protein; putative lactonase, structur 86.9
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 86.87
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 86.78
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 86.75
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 86.74
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 86.42
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 86.41
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 86.39
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 86.37
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 86.36
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 86.34
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 86.24
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 86.14
1ck7_A631 Protein (gelatinase A); hydrolase (metalloprotease 86.13
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 86.12
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 86.09
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 85.7
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 85.58
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 85.53
4e54_B435 DNA damage-binding protein 2; beta barrel, double 85.39
2pm7_B297 Protein transport protein SEC13, protein transport 85.08
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 84.83
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 84.77
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 84.76
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 84.71
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 84.57
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 84.27
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 84.22
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 83.96
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 83.77
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 83.54
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 83.5
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 83.36
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 83.12
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 83.11
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 82.98
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 82.52
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 82.48
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 82.29
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 82.03
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 81.98
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 81.55
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 81.44
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 81.22
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 80.95
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 80.66
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 80.51
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 80.18
2ymu_A577 WD-40 repeat protein; unknown function, two domain 80.16
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=3e-42  Score=333.93  Aligned_cols=275  Identities=22%  Similarity=0.369  Sum_probs=228.0

Q ss_pred             CCCccEEEEEEeecCC-ceeEEEeCCCCCceeeCCCCCCccchhhhhccceeEeeeeeeccceeeeeeeccccccccccC
Q 011952           90 GTTEEWLYILTKVEDD-KLSWHALDPLAGRWQRLPPMPSIIFEDELRRGSAAIRMWNVLGSTIKIADLIRGWLGKKDALD  168 (474)
Q Consensus        90 ~~~~~~l~v~gg~~~~-~~~~~~yd~~~~~W~~l~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~  168 (474)
                      ...++.||++||.... ...+++||+.+++|..++++|.+                                        
T Consensus        21 ~~~~~~i~v~GG~~~~~~~~~~~~d~~~~~W~~~~~~p~~----------------------------------------   60 (308)
T 1zgk_A           21 PKVGRLIYTAGGYFRQSLSYLEAYNPSNGTWLRLADLQVP----------------------------------------   60 (308)
T ss_dssp             CCCCCCEEEECCBSSSBCCCEEEEETTTTEEEECCCCSSC----------------------------------------
T ss_pred             cCCCCEEEEEeCcCCCCcceEEEEcCCCCeEeECCCCCcc----------------------------------------
Confidence            3457899999997322 23799999999999999887765                                        


Q ss_pred             CCCccceeEEEeCCEEEEEcCc----CCCcccceEEEEeCCCCceeecCCCCCCcceeeEEEECCEEEEEeceecCCCCC
Q 011952          169 RMGFCGCSIGAVDGCLYVLGGF----SRALAMRNVWRYDPVLNAWSEVSSMSVGRAYSKIGILNNKLYAVGGVTRGPGGL  244 (474)
Q Consensus       169 p~pr~~~~~~~~~~~lyv~GG~----~~~~~~~~v~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~  244 (474)
                         |..|+++.++++||++||.    +.....+++++||+.+++|+.+++||.+|..|++++++++|||+||..    +.
T Consensus        61 ---r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~----~~  133 (308)
T 1zgk_A           61 ---RSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSH----GC  133 (308)
T ss_dssp             ---CBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECCCCSSCCBTCEEEEETTEEEEECCEE----TT
T ss_pred             ---cccceEEEECCEEEEECCCcCCCCCCeecceEEEECCCCCeEeECCCCCcCccccEEEEECCEEEEEcCCC----CC
Confidence               8899999999999999998    455668899999999999999999999999999999999999999986    33


Q ss_pred             ccCceEEEEeCCCCceEEccCCCccccccccchhhccccccceeeEEEeCCEEEEeccCCCCcceeccceEEEcCCCCce
Q 011952          245 TPLQSAEVFDPRTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMSSYRGRLFVPQSLYFWPFFVDVGGEVYDPDVNSW  324 (474)
Q Consensus       245 ~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~~~~~~~~~~~~~~~~iyv~gG~~~~~~~~~~gg~~yd~~t~~W  324 (474)
                      ..++++++||+.+++|+.++++|.+|..               +++++++++||++||.++.....++  ++||+.+++|
T Consensus       134 ~~~~~~~~yd~~~~~W~~~~~~p~~r~~---------------~~~~~~~~~iyv~GG~~~~~~~~~~--~~yd~~~~~W  196 (308)
T 1zgk_A          134 IHHNSVERYEPERDEWHLVAPMLTRRIG---------------VGVAVLNRLLYAVGGFDGTNRLNSA--ECYYPERNEW  196 (308)
T ss_dssp             EECCCEEEEETTTTEEEECCCCSSCCBS---------------CEEEEETTEEEEECCBCSSCBCCCE--EEEETTTTEE
T ss_pred             cccccEEEECCCCCeEeECCCCCccccc---------------eEEEEECCEEEEEeCCCCCCcCceE--EEEeCCCCeE
Confidence            4678999999999999999999999998               8889999999999998876554444  9999999999


Q ss_pred             EEcCCCCCCCCCccccCcceEEEECCEEEEEcCCCCC-CCceEEEEECCCCceEEeccCCCCCCCCCCCCCeEEEeeCCE
Q 011952          325 VEMPVGMGEGWPVRQAGTKLSITVEGELYALDPSGAL-DSAKIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGK  403 (474)
Q Consensus       325 ~~~~~~~~~~~p~~~~~~~~~~~~~~~lyv~GG~~~~-~~~~v~~yd~~~~~W~~v~~~~p~~~~~~~r~~~~~~~~~~~  403 (474)
                      +.+++ +    |.++.+++ +++++++|||+||.+.. ..+++++||+++++|+++.      .++.+|..++++.++++
T Consensus       197 ~~~~~-~----p~~r~~~~-~~~~~~~iyv~GG~~~~~~~~~v~~yd~~~~~W~~~~------~~p~~r~~~~~~~~~~~  264 (308)
T 1zgk_A          197 RMITA-M----NTIRSGAG-VCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVA------PMKHRRSALGITVHQGR  264 (308)
T ss_dssp             EECCC-C----SSCCBSCE-EEEETTEEEEECCBCSSSBCCCEEEEETTTTEEEECC------CCSSCCBSCEEEEETTE
T ss_pred             eeCCC-C----CCccccce-EEEECCEEEEEeCCCCCCccceEEEEeCCCCcEEECC------CCCCCccceEEEEECCE
Confidence            99976 4    44666666 78889999999997543 3679999999999999985      34567888999999999


Q ss_pred             EEEEecCCCCceeEEEEeecCCCCCCCCCCCCCCccccCCCCCCcccceeeeeeccccCCc
Q 011952          404 LHVITNDANHNIAVLQADVKNHFASMPSASSSSFHDCINEPASGSETDTWKMIAIRNAGSA  464 (474)
Q Consensus       404 l~v~GG~~~~~~~~~~~d~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~W~~~~~~~~~~~  464 (474)
                      |||+||..... ....+  +                     .||+++++|+.++....++.
T Consensus       265 i~v~GG~~~~~-~~~~v--~---------------------~yd~~~~~W~~~~~~p~~r~  301 (308)
T 1zgk_A          265 IYVLGGYDGHT-FLDSV--E---------------------CYDPDTDTWSEVTRMTSGRS  301 (308)
T ss_dssp             EEEECCBCSSC-BCCEE--E---------------------EEETTTTEEEEEEECSSCCB
T ss_pred             EEEEcCcCCCc-ccceE--E---------------------EEcCCCCEEeecCCCCCCcc
Confidence            99999965432 11111  1                     46778899999977544433
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 474
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-10
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-09
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 8e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-04
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-09
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-09
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-09
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 5e-04
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 3e-04
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 0.001
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: Galactose oxidase, central domain
family: Galactose oxidase, central domain
domain: Galactose oxidase, central domain
species: Fungi (Fusarium sp.) [TaxId: 29916]

 Score = 60.6 bits (145), Expect = 1e-10
 Identities = 19/92 (20%), Positives = 36/92 (39%), Gaps = 9/92 (9%)

Query: 172 FCGCSIGAVDGCLYVLGG------FSRALAMRNVWRYDPVLNAWSEVSSMSVGRAYSKIG 225
               S+   DG  ++ GG      F  +  +     Y P  + + + +  S+ R Y  I 
Sbjct: 290 TFHTSVVLPDGSTFITGGQRRGIPFEDSTPVFTPEIYVPEQDTFYKQNPNSIVRVYHSIS 349

Query: 226 IL--NNKLYAVGGVTRGPGGLTPLQSAEVFDP 255
           +L  + +++  GG   G         A++F P
Sbjct: 350 LLLPDGRVFNGGGGLCGDCTTN-HFDAQIFTP 380
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query474
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.95
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.92
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 98.86
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.03
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 97.84
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.63
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 96.92
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 96.59
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 96.02
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 95.3
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.19
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 94.91
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 94.78
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 94.06
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 93.98
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 93.94
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 93.66
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 93.01
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 92.59
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 92.58
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 92.4
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 92.39
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 92.33
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 91.9
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 91.67
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 91.12
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 90.71
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 90.51
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 90.1
d1hxna_210 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 89.58
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 89.51
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.43
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 89.3
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 89.29
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 88.85
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 88.33
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 88.12
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 87.49
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 87.49
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 87.29
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 85.94
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 84.68
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 83.24
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 82.42
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 81.97
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 81.14
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.5e-37  Score=292.32  Aligned_cols=271  Identities=23%  Similarity=0.389  Sum_probs=224.7

Q ss_pred             CccEEEEEEeecCCce-eEEEeCCCCCceeeCCCCCCccchhhhhccceeEeeeeeeccceeeeeeeccccccccccCCC
Q 011952           92 TEEWLYILTKVEDDKL-SWHALDPLAGRWQRLPPMPSIIFEDELRRGSAAIRMWNVLGSTIKIADLIRGWLGKKDALDRM  170 (474)
Q Consensus        92 ~~~~l~v~gg~~~~~~-~~~~yd~~~~~W~~l~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~p~  170 (474)
                      .+..||++||...... .+++||+.+++|.+++++|.+                                          
T Consensus         3 ~g~~iyv~GG~~~~~~~~~~~yd~~t~~W~~~~~~p~~------------------------------------------   40 (288)
T d1zgka1           3 VGRLIYTAGGYFRQSLSYLEAYNPSNGTWLRLADLQVP------------------------------------------   40 (288)
T ss_dssp             CCCCEEEECCBSSSBCCCEEEEETTTTEEEECCCCSSC------------------------------------------
T ss_pred             cCCEEEEECCcCCCCCceEEEEECCCCeEEECCCCCCc------------------------------------------
Confidence            3568999999875544 789999999999999988865                                          


Q ss_pred             CccceeEEEeCCEEEEEcCcCC----CcccceEEEEeCCCCceeecCCCCCCcceeeEEEECCEEEEEeceecCCCCCcc
Q 011952          171 GFCGCSIGAVDGCLYVLGGFSR----ALAMRNVWRYDPVLNAWSEVSSMSVGRAYSKIGILNNKLYAVGGVTRGPGGLTP  246 (474)
Q Consensus       171 pr~~~~~~~~~~~lyv~GG~~~----~~~~~~v~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~  246 (474)
                       |.+|++++++++|||+||...    ....+++++||+.+++|+++++||.+|..|++++++++||++||..    +...
T Consensus        41 -R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~~w~~~~~~p~~r~~~~~~~~~~~i~~~gg~~----~~~~  115 (288)
T d1zgka1          41 -RSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSH----GCIH  115 (288)
T ss_dssp             -CBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECCCCSSCCBTCEEEEETTEEEEECCEE----TTEE
T ss_pred             -cceeEEEEECCEEEEEeCcccCCCCccccchhhhcccccccccccccccceecceeccccceeeEEeccee----cccc
Confidence             999999999999999999742    3457899999999999999999999999999999999999999986    4456


Q ss_pred             CceEEEEeCCCCceEEccCCCccccccccchhhccccccceeeEEEeCCEEEEeccCCCCcceeccceEEEcCCCCceEE
Q 011952          247 LQSAEVFDPRTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMSSYRGRLFVPQSLYFWPFFVDVGGEVYDPDVNSWVE  326 (474)
Q Consensus       247 ~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~~~~~~~~~~~~~~~~iyv~gG~~~~~~~~~~gg~~yd~~t~~W~~  326 (474)
                      ++..+.||+.++.|...+.++.+|..               ++++..++++|++||........++  +.||+.+++|..
T Consensus       116 ~~~~~~~~~~~~~~~~~~~~~~~r~~---------------~~~~~~~~~~~~~GG~~~~~~~~~~--~~~d~~~~~~~~  178 (288)
T d1zgka1         116 HNSVERYEPERDEWHLVAPMLTRRIG---------------VGVAVLNRLLYAVGGFDGTNRLNSA--ECYYPERNEWRM  178 (288)
T ss_dssp             CCCEEEEETTTTEEEECCCCSSCCBS---------------CEEEEETTEEEEECCBCSSCBCCCE--EEEETTTTEEEE
T ss_pred             cceeeeeccccCcccccccccccccc---------------ceeeeeeecceEecCcccccccceE--EEeecccccccc
Confidence            78899999999999999999999988               8889999999999998776655544  999999999999


Q ss_pred             cCCCCCCCCCccccCcceEEEECCEEEEEcCCCCC-CCceEEEEECCCCceEEeccCCCCCCCCCCCCCeEEEeeCCEEE
Q 011952          327 MPVGMGEGWPVRQAGTKLSITVEGELYALDPSGAL-DSAKIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGKLH  405 (474)
Q Consensus       327 ~~~~~~~~~p~~~~~~~~~~~~~~~lyv~GG~~~~-~~~~v~~yd~~~~~W~~v~~~~p~~~~~~~r~~~~~~~~~~~l~  405 (474)
                      .+. .    +..+..++ ++..+++||++||.... ...+.+.||..+++|+.+.      ..+.+|..++++.++++||
T Consensus       179 ~~~-~----~~~~~~~~-~~~~~~~i~i~GG~~~~~~~~~~~~~~~~~~~~~~~~------~~p~~r~~~~~~~~~~~l~  246 (288)
T d1zgka1         179 ITA-M----NTIRSGAG-VCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVA------PMKHRRSALGITVHQGRIY  246 (288)
T ss_dssp             CCC-C----SSCCBSCE-EEEETTEEEEECCBCSSSBCCCEEEEETTTTEEEECC------CCSSCCBSCEEEEETTEEE
T ss_pred             ccc-c----cccccccc-ccceeeeEEEecCccccccccceeeeeecceeeeccc------CccCcccceEEEEECCEEE
Confidence            876 2    22344444 88999999999996543 3578999999999999985      3456788899999999999


Q ss_pred             EEecCCCCceeEEEEeecCCCCCCCCCCCCCCccccCCCCCCcccceeeeeeccccC
Q 011952          406 VITNDANHNIAVLQADVKNHFASMPSASSSSFHDCINEPASGSETDTWKMIAIRNAG  462 (474)
Q Consensus       406 v~GG~~~~~~~~~~~d~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~W~~~~~~~~~  462 (474)
                      |+||..+.. ....++                       .||+++++|+.+++...+
T Consensus       247 v~GG~~~~~-~~~~v~-----------------------~yd~~~~~W~~~~~~p~~  279 (288)
T d1zgka1         247 VLGGYDGHT-FLDSVE-----------------------CYDPDTDTWSEVTRMTSG  279 (288)
T ss_dssp             EECCBCSSC-BCCEEE-----------------------EEETTTTEEEEEEECSSC
T ss_pred             EEecCCCCe-ecceEE-----------------------EEECCCCEEEECCCCCCC
Confidence            999964432 111111                       478888999999874333
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1hxna_ b.66.1.1 (A:) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure