Citrus Sinensis ID: 011958

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470----

MASRKLVRDLFLSRQRPRFLQLTPLQGSSTRLRLVSANGYSSNRQFSVFKEFSKKIKGEAESNPEFKHSVKELKKKAEEIKGVKEELKERTKQTTEQLYKQVDGVWMEAESTVKKVSASMKEKISAATEEVKGTFRTGSTDTSAKHDDDVRDGFKASSGEEKQKQTVSSDTAETFYGKLKSSISSPKFTLAFQKLKEAKVVDLAKKGYDIVKDELSGSPSKRKHLEYTPSPSWTGEKSTRTDLVVTPSKKSMWSKLKEKMQGYPVFKRITGISEPVVTKGQEIAEDVRERWETSDNPIVHKIQDMNETIFQETDAAASIKEIRRRDPSFSLPDFVSEVQEAIRPVLSAYMKANVETLKKYCSPEVIERCKAEHTAYQSHGIFFDNRILHVSEVEVRETKMMGSSPIIIVAFQTQQIYCVRDKHGTITEGGKDTIQTVYYAWAMQQVDAEELGEDVLYPIWKLREMQQLGVQALI

ccHHHHHHHHHHHccccccccccccccccccEEEEccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccccccccccccccccccccccccEEEcccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccHHHHHHHHHHHHHHHHcccCCccEEEECcccEEEEEEEcccccEEEEEEEEEEEEEEEcccccEEccccccEEEEEEEEEEEEEcccccccccccccEEEEEEEcccccccc

******V*DLFLS*****FL*****************************KEFSK**********************************************QVDGVWM*************KEKISAATEEVKGTFRTGS***********************************************KFTLAFQKLKEAKVV*L********************************************************MQGYPVFKRITGISEPVVTKGQEIAEDVRERWETSDNPIVHKIQDMNETIFQETDAAASIKEIRRRDPSFSLPDFVSEVQEAIRPVLSAYMKANVETLKKYCSPEVIERCKAEHTAYQSHGIFFDNRILHVSEVEVRETKMMGSSPIIIVAFQTQQIYCVRDKHGTITEGGKDTIQTVYYAWAMQQVDAEELGEDVLYPIWKLREMQQLGVQA*I

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASRKLVRDLFLSRQRPRFLQLTPLQGSSTRLRLVSANGYSSNRQFSVFKEFSKKIKGEAESNPEFKHSxxxxxxxxxxxxxxxxxxxxxxxxxxxxLYKQVDGVWMEAESTVKKVSASMKEKISAATEEVKGTFRTGSTDTSAKHDDDVRDGFKASSGEEKQKQTVSSDTAETFYGKLKSSISSPKFTLAFQKLKEAKVVDLAKKGYDIVKDELSGSPSKRKHLEYTPSPSWTGEKSTRTDLVVTPSKKSMWSKLKEKMQGYPVFKRITGISEPVVTKGQEIAEDVRERWETSDNPIVHKIQDMNETIFQETDAAASIKEIRRRDPSFSLPDFVSEVQEAIRPVLSAYMKANVETLKKYCSPEVIERCKAEHTAYQSHGIFFDNRILHVSEVEVRETKMMGSSPIIIVAFQTQQIYCVRDKHGTITEGGKDTIQTVYYAWAMQQVDAEELGEDVLYPIWKLREMQQLGVQALI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mitochondrial import inner membrane translocase subunit TIM44-2	Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Recruits mitochondrial HSP70 to drive protein translocation into the matrix using ATP as an energy source.	probable	Q5XF06

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QK9, chain A
Confidence level:very confident
Coverage over the Query: 270,286-473
View the alignment between query and template
View the model in PyMOL