BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 011963
         (474 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4GND|A Chain A, Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains
 pdb|4GND|C Chain C, Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains
 pdb|4GNE|A Chain A, Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains
           Complexed With H3 Peptide 1-7
 pdb|4GNF|A Chain A, Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains
           Complexed With H3 Peptide 1-15
 pdb|4GNG|A Chain A, Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains
           Complexed With H3k9me3 Peptide
 pdb|4GNG|D Chain D, Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains
           Complexed With H3k9me3 Peptide
          Length = 107

 Score = 30.0 bits (66), Expect = 3.3,   Method: Composition-based stats.
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 160 CANGHHGQACEKLDCPSKFLILCLN 184
           C +G     C+K DCP  + +LCLN
Sbjct: 21  CGDGGELVMCDKKDCPKAYHLLCLN 45


>pdb|1YAV|A Chain A, Crystal Structure Of Cbs Domain-Containing Protein Ykul
           From Bacillus Subtilis
 pdb|1YAV|B Chain B, Crystal Structure Of Cbs Domain-Containing Protein Ykul
           From Bacillus Subtilis
          Length = 159

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 12/44 (27%), Positives = 24/44 (54%)

Query: 375 AVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGI 418
            V+ ++L  I RL +N  +      +I +  VC  ++E++ +GI
Sbjct: 87  TVEEVMLTDIPRLHINDPIMKGFGMVINNGFVCVENDEQVFEGI 130


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.132    0.385 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,663,922
Number of Sequences: 62578
Number of extensions: 415490
Number of successful extensions: 967
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 965
Number of HSP's gapped (non-prelim): 3
length of query: 474
length of database: 14,973,337
effective HSP length: 102
effective length of query: 372
effective length of database: 8,590,381
effective search space: 3195621732
effective search space used: 3195621732
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)