Citrus Sinensis ID: 011971


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470----
MDDPTESPQLNLPPTMSLQPLTPPSDHISRMINANHHQSPSRAIYSDRFIPSRSSSNFDLFNISQPSPNSPAVTDSHKDDNSGTYTALLRAALFGPETPEKKDVLGPPSGRNIFRFKSETRRSLHSLSPFGFDDDVASGVSHSPVKAPRKVPRSPYKILDAPALQDDFYLNLVDWSSHNVLAVGLGNCVYLWNACSSKVTKLCDLGIDDSVCSVGWANRNTHLAVGTSHGKVQIWDASRCKRVRTMEGHRLRVGALAWSSSLLSSGSRDKSILQRDIRAQEDFVSKLSGHKSEVCGLKWSYDNRELASGGNDNRLFVWNQHSTQPVLKYCEHTAAVKAIAWSPHLHGLLASGGGTADRCIRFWNTTTNTHLSCMDTGSQVCNLVWSKNVNELVSTHGYSQNQIIVWRYPTMSKLATLTGHTFRVLYLAISPDGQTIVTGAGDETLRFWNVFPSPKSQNTDSEIGASSLGRTTIR
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccCEECccccccccEEEEECcccccEEEEEcccEEEEEEcccccEEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEcccccccEEEEEEcccEEEEECccccEEEEEcccccccccccccccccEEEEEEcccccEEEEECccccEEEEccccccEEEEEccccccEEEEEEccccccEEECccccccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEccccccccEEEEEcccccEEEEECcccccEEEEEEcccccEEEECcccccEEEEEccccccccccccccccccccccccc
************************************************FIPSRSSSNFD**************************TALLRAALFG******************************************************KVPRSPYKILDAPALQDDFYLNLVDWSSHNVLAVGLGNCVYLWNACSSKVTKLCDLGIDDSVCSVGWANRNTHLAVGTSHGKVQIWDASRCKRVRTMEGHRLRVGALAWSSSLLSSGSRDKSILQRDIRAQEDFVSKLSGHKSEVCGLKWSYDNRELASGGNDNRLFVWNQHSTQPVLKYCEHTAAVKAIAWSPHLHGLLASGGGTADRCIRFWNTTTNTHLSCMDTGSQVCNLVWSKNVNELVSTHGYSQNQIIVWRYPTMSKLATLTGHTFRVLYLAISPDGQTIVTGAGDETLRFWNVF****************LGRTTIR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDPTESPQLNLPPTMSLQPLTPPSDHISRMINANHHQSPSRAIYSDRFIPSRSSSNFDLFNISQPSPNSPAVTDSHKDDNSGTYTALLRAALFGPETPEKKDVLGPPSGRNIFRFKSETRRSLHSLSPFGFDDDVASGVSHSPVKAPRKVPRSPYKILDAPALQDDFYLNLVDWSSHNVLAVGLGNCVYLWNACSSKVTKLCDLGIDDSVCSVGWANRNTHLAVGTSHGKVQIWDASRCKRVRTMEGHRLRVGALAWSSSLLSSGSRDKSILQRDIRAQEDFVSKLSGHKSEVCGLKWSYDNRELASGGNDNRLFVWNQHSTQPVLKYCEHTAAVKAIAWSPHLHGLLASGGGTADRCIRFWNTTTNTHLSCMDTGSQVCNLVWSKNVNELVSTHGYSQNQIIVWRYPTMSKLATLTGHTFRVLYLAISPDGQTIVTGAGDETLRFWNVFPSPKSQNTDSEIGASSLGRTTIR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein FIZZY-RELATED 2 Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C). Necessary and sufficient for endoreduplication and correct cell expansion.confidentQ8L3Z8
Fizzy-related protein homolog Key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. Associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.probableQ9UM11
Fizzy-related protein homolog Key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. Associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.probableQ9R1K5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GGA, chain A
Confidence level:very confident
Coverage over the Query: 148-455
View the alignment between query and template
View the model in PyMOL