Citrus Sinensis ID: 012029

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470--

MSARRGGKSPIAAGSSNTSVKGKNVTEVSNSQVDHLSGSVADISLDSAQDDGGWEVYVRKSKNKAGSGTTKSFGSQNSNYKAWGHLDSTQKPGMRGNGSSGRAPAKTWTTVNADSKIPAGRVNARPQLTNWVPETNNMATQTGIRPPLEHGWNWQSRAGSTIFKHSEDGHDKESGNLDEVHKDNVEDDYDDEKDDDSNVSDDSDDELLSDEFDSDTSQKSHDTRKKSRWFKKFFESLESLTVEEINEPARQWHCPACQGGPGAIDWYRGLQPLMTHAKTKGSKRVKLHRELAELLDEELRRRGTSVIPAGEVFGKWKGLKDTEKDHEIVWPPMVIIMNTRLDKDENDKWTGMGNQELLEYFILYAAVRARHSYGPQGHRGMSVLIFESSAGGYLEAERLHKHFAEQGTDRDSWNNSNRRVLFHAGGKRQLYGFMALKEDLDVFNQHCHGSSFSPLSLSLSLTHTHTHVHRHA

cccccccccccccccccccccccCEECcccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccHHcccccccCCcccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccCEccccEEEEEEcccccccccccccccHHHHHHHHccccccEEEEcccccccccEEEEEEccccccHHHHHHHHHHHHHccccHHHHHccccccccccccEEEEEEEEEEcccHHHHccccccccccccccccccccccccccccc

*****************************************************WEVY**************************************************************************************I**PLEH*****************************************************************************RWFKKFFESLESLTVEEINEPARQWHCPACQGGPGAIDWYRGLQPLMTHA********KLHRELAELLDEELRRRGTSVIPAGEVFGKWKGLKDTEKDHEIVWPPMVIIMNTRLDKDENDKWTGMGNQELLEYFILYAAVRARHSYGPQGHRGMSVLIFESSAGGYLEAERLHKHFAEQGTDRDSWNNSNRRVLFHAGGKRQLYGFMALKEDLDVFNQHCHGSSFSPLSLSLSLTHT********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein SUPPRESSOR OF GENE SILENCING 3	Required for post-transcriptional gene silencing and natural virus resistance. May bind nucleic acids and is essential for the biogenesis of trans-acting siRNAs but is not required for silencing induced by IR-PTGS. Involved in the juvenile-to-adult transition regulation. In case of begomoviruses infection, it is targeted by the viral protein V2 leading to suppression of post-transcriptional gene silencing.	probable	Q9LDX1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4E8U, chain A
Confidence level:very confident
Coverage over the Query: 325-455
View the alignment between query and template
View the model in PyMOL