Citrus Sinensis ID: 012063

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-

MAQVKHHVACMPSPGMGHLIPHVELAKQLVLRHDISVTFLVPTIGPPSKAITSVLQGLPEHINHVLLPPVNFEEDVKAEIQIVLAIKRSLSSVRDVFKSLVASTHLMALVVDPFGTDVFDVAREFYVPSYLYFLTNALSLSLLHYMPKLDEVISCEVRDMEQPLKLPGFTIPIHGRDFPDPLQDRKNDAYRFMIQIRKRYSLADGILINTFMELEPGVIKALQEEPSMRSIYPIGPIIRTVSDGELVDGSESHQCMCIRWLDNQASGSVLFVSFGSGGTLSYDQLEELALGLELSEQQFLWVVKSPDDKSASGSFFDVHSKTDPFGFLPTGFLDRTKEQGLVVPSWAPQVEVLGHPSTGGFLTHCGWNSTLESIVHGVPLIAWPLYAEQRLNAVILSEDLNVALRPPEYENGLIKREEIAKVIKGLMHGEDGVIIRDRMNRLKDAAAAAVSDGGSSTKTLSQLVHKWKNQN

ccccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHcccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEccccHHHHHHHHHHccccEEEEHHHHHHHHHHHHHHHHHcccccccccccccEEccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEcccHHHcHHHHHHHHHcccccccccccccccccccccccccccccccccccHHcccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccHHHHHHccccEEEcccccHHHHHccccccEEcccccccHHHHHHHcccccccccccccccHHHHHHHHHcccEEEccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcc

**QVKHHVACMPSPGMGHLIPHVELAKQLVLRHDISVTFLVPTIGPPSKAITSVLQGLPEHINHVLLPPVNFEEDVKAEIQIVLAIKRSLSSVRDVFKSLVASTHLMALVVDPFGTDVFDVAREFYVPSYLYFLTNALSLSLLHYMPKLDEVISCEVRDMEQPLKLPGFTIPIHGRDFPDPLQDRKNDAYRFMIQIRKRYSLADGILINTFMELEPGVIKALQEEPSMRSIYPIGPIIRTVSDGELVDGSESHQCMCIRWLDNQASGSVLFVSFGSGGTLSYDQLEELALGLELSEQQFLWVVKSPDD*****S*F**HSKTDPFGFLPTGFLDRTKEQGLVVPSWAPQVEVLGHPSTGGFLTHCGWNSTLESIVHGVPLIAWPLYAEQRLNAVILSEDLNVALRPPEYENGLIKREEIAKVIKGLMHGEDGVIIRDRMNRLKDAAAAAVSDGGSSTKTLSQLVHKWKN**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UDP-glycosyltransferase 72B1	Bifunctional O-glycosyltransferase and N-glycosyltransferase that can detoxify xenobiotics. Possesses high activity to metabolize the peristent pollutants 2,4,5-trichlorophenol (TCP) and 3,4-dichloroaniline (DCA). Also active on benzoates and benzoate derivatives in vitro.	probable	Q9M156
Hydroquinone glucosyltransferase	Broad spectrum multifunctional glucosyltransferase. In addition to hydroquinone it accept at least 45 natural and synthetic phenols as well as two cinnamyl alcohols as substrates. Hydroquinone was however the best substrate. In contrast to this broad acceptor substrate specificity, only pyrimidine nucleotide activated glucose is tolerated as a donor substrate.	probable	Q9AR73

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.4.-.-	Glycosyltransferases.	probable
2.4.1.-	Hexosyltransferases.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VCH, chain A
Confidence level:very confident
Coverage over the Query: 5-469
View the alignment between query and template
View the model in PyMOL