Citrus Sinensis ID: 012068

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-
MRETLSLGFSFSLAIFLFSSITAIINVAALTKQQKLDRISALPGQPPVTFSQFSGYVTVNENHGRALFYWLTEAASSALKKPLVLWLNGGPGCSSVAYGASEEIGPFRINRNGSSLYLNKYSWSREANILFLESPAGVGFSYTNTSSNLKDSGDNRTAQDALVFLIRWMSRFPQYKYREFYIAGESYAGHYVPQLAKKIIDYNSAYSRPIINLKGFIVGNAVTDNYYDSIGTVTFWWTHSMISDKTYRSIINHCNFSAEKSSKKCDDTVNYAMNHEFGDIDQYSIYTPSCIALPNSTVRPMRLKNTLLRRRVSGYDPCTENYAEKYYNRQEVQKALHANVTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKIWVFSGDTDSVVPVTATRFSLSHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEVPLFQPRRALILFRSFLAGKQLPKSRHISQR
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEEcccccEEEEEEEEEEccccccccEEEEEccccccccccHHHHHccccEEEccccccEEEcccccccCEEEEEECccccccCCcccccccccccccHHHHHHHHHHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHHccccccccCEEEEEEEEccccccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHcccHHHHHHHcccccccccccccccHHHHHcccccccccHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHccccccEEcEEccEEccEEEEEEEEEccEEEEEEccccccccccccHHHHHHHHHHHcccccccccccccc
*****SLGFSFSLAIFLFSSITAIINVAALTKQQKLDRISALPGQPPVTFSQFSGYVTVNENHGRALFYWLTEAASSALKKPLVLWLNGGPGCSSVAYGASEEIGPFRINRNGSSLYLNKYSWSREANILFLESPAGVGFSYTNTSSNLKDSGDNRTAQDALVFLIRWMSRFPQYKYREFYIAGESYAGHYVPQLAKKIIDYNSAYSRPIINLKGFIVGNAVTDNYYDSIGTVTFWWTHSMISDKTYRSIINHCNFSAEKSSKKCDDTVNYAMNHEFGDIDQYSIYTPSCIALPNS*******KNTLLRRRVSGYDPCTENYAEKYYNRQEVQKALHANVTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKIWVFSGDTDSVVPVTATRFSLSHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEVPLFQPRRALILFRSFLAGKQ**********
xxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRETLSLGFSFSLAIFLFSSITAIINVAALTKQQKLDRISALPGQPPVTFSQFSGYVTVNENHGRALFYWLTEAASSALKKPLVLWLNGGPGCSSVAYGASEEIGPFRINRNGSSLYLNKYSWSREANILFLESPAGVGFSYTNTSSNLKDSGDNRTAQDALVFLIRWMSRFPQYKYREFYIAGESYAGHYVPQLAKKIIDYNSAYSRPIINLKGFIVGNAVTDNYYDSIGTVTFWWTHSMISDKTYRSIINHCNFSAEKSSKKCDDTVNYAMNHEFGDIDQYSIYTPSCIALPNSTVRPMRLKNTLLRRRVSGYDPCTENYAEKYYNRQEVQKALHANVTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKIWVFSGDTDSVVPVTATRFSLSHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEVPLFQPRRALILFRSFLAGKQLPKSRHISQR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine carboxypeptidase 24 Active serine carboxypeptidase with broad substrate preference, including basic and hydrophilic groups. Processes a protein involved in an early event in the brassinosteroid signaling pathway.confidentQ9M099
Serine carboxypeptidase II-2 (Fragment) probableP55748
Serine carboxypeptidase II-3 probableP52711

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.16.-Serine-type carboxypeptidases.probable
3.4.16.6Transferred entry: 3.4.16.5 and 3.4.16.6.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WHS, chain B
Confidence level:very confident
Coverage over the Query: 315-464
View the alignment between query and template
View the model in PyMOL
Template: 1WHS, chain A
Confidence level:very confident
Coverage over the Query: 35-291
View the alignment between query and template
View the model in PyMOL
Template: 1IVY, chain A
Confidence level:very confident
Coverage over the Query: 35-462
View the alignment between query and template
View the model in PyMOL