BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 012070
(471 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3VPS|A Chain A, Structure Of A Novel Nad Dependent-Ndp-Hexosamine
5,6-Dehydratase, Tuna, Involved In Tunicamycin
Biosynthesis
pdb|3VPS|B Chain B, Structure Of A Novel Nad Dependent-Ndp-Hexosamine
5,6-Dehydratase, Tuna, Involved In Tunicamycin
Biosynthesis
Length = 321
Score = 33.1 bits (74), Expect = 0.33, Method: Compositional matrix adjust.
Identities = 18/54 (33%), Positives = 30/54 (55%)
Query: 357 LEDTRVMPVIWHQSLLAFVQRYKNELQKEDKDDLRILLKKQKHKLVRLSFLMPI 410
L+D RV P+I + F+++ EL++ D D+R++ HK V SF P+
Sbjct: 37 LDDLRVPPMIPPEGTGKFLEKPVLELEERDLSDVRLVYHLASHKSVPRSFKQPL 90
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.136 0.388
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,302,051
Number of Sequences: 62578
Number of extensions: 409117
Number of successful extensions: 734
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 733
Number of HSP's gapped (non-prelim): 1
length of query: 471
length of database: 14,973,337
effective HSP length: 102
effective length of query: 369
effective length of database: 8,590,381
effective search space: 3169850589
effective search space used: 3169850589
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (25.0 bits)