BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 012139
         (470 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1STZ|A Chain A, Crystal Structure Of A Hypothetical Protein At 2.2 A
           Resolution
 pdb|1STZ|B Chain B, Crystal Structure Of A Hypothetical Protein At 2.2 A
           Resolution
 pdb|1STZ|C Chain C, Crystal Structure Of A Hypothetical Protein At 2.2 A
           Resolution
          Length = 338

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 23/52 (44%)

Query: 364 NGTSFYKLEMTKIQPILAHAHQAAVDIEDYRKAQPDVIAHSAANIISRLKAG 415
            G  FY  EM KI    + A  A    +    A P+ +   A N+++RL  G
Sbjct: 82  KGLRFYYEEMLKISKETSEADLAVETFKSMPLADPEKVLFLAGNLLARLTEG 133


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.130    0.382 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,400,100
Number of Sequences: 62578
Number of extensions: 481263
Number of successful extensions: 954
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 953
Number of HSP's gapped (non-prelim): 4
length of query: 470
length of database: 14,973,337
effective HSP length: 102
effective length of query: 368
effective length of database: 8,590,381
effective search space: 3161260208
effective search space used: 3161260208
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)