Citrus Sinensis ID: 012142


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470
MIWGIVRRKITSAQVIGQSVSKIGPRCHATAQKEAILTCRGFQRVQRSSYHILSGNYVCSTPRSEVIELIQKGSFIGSRSRLFSSDSGDLVDAVVPFMGESITDGTLAKFLKQPGDRVEMDEPIAQIETDKVTIDVASPQAGVIQNLIAKEGETVEPGAKIAVISKSGEGVAQAASAEKAAAQPPPAEEKPSAEKQTPESEAAPAVKDKTPSEPPPTAKKPTSPPSKPMASEPQLPPKDRERRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSDYKDAFLEKHGVKLGLMSGFVKAAVSALQHQPVVNAVIDGDDIIYRDYIDISFAVGTKKGLVVPVIRNSERMNFAEIEKEISTLAKKANDGSISIDEMAGGTFTISNGGVYGSLLSTPIINPPQSAILGMHSIVNRPMVVGGNVVPRPMMYIALTYDHRLIDGREAVFFLRRIKDIVEDPRRLLLDI
ccccHHHHccccccHHccccccccccccccHHHHHHHHHccccccccccCECcccccccccccHHHHHHHHcccccccccccccccccccEEEEcccccccccEEEEEEEcccccccccccccEEEEEccEEEEEEccccccEEEEEEcccccCEccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccEECcccEEEccccEEEEEEEccccEEECcccccccccHHHHHHHHHHHHHHHHcccccccccccccEEEccccccccccccccccccccHHccccccccccEECccCEEEcccEEEEccccccccccHHHHHHHHHHHHHHccHHHHHccc
*IWGIVRRKITSAQVIGQSVSKIGPRCHATAQKEAILTCRGFQRVQRSSYHILSGNYVCS******I*******FIGSRSRLFSSDSGDLVDAVVPFMGESITDGTLAKFLKQPGDRVEMDEPIAQIETDKVTIDVASPQAGVIQNLIAKEGETVEPGAKIA**************************************************************************************LRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSDYKDAFLEKHGVKLGLMSGFVKAAVSALQHQPVVNAVIDGDDIIYRDYIDISFAVGTKKGLVVPVIRNSERMNFAEIEKEISTLAKKANDGSISIDEMAGGTFTISNGGVYGSLLSTPIINPPQSAILGMHSIVNRPMVVGGNVVPRPMMYIALTYDHRLIDGREAVFFLRRIKDIVEDPRRLLLDI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIWGIVRRKITSAQVIGQSVSKIGPRCHATAQKEAILTCRGFQRVQRSSYHILSGNYVCSTPRSEVIELIQKGSFIGSRSRLFSSDSGDLVDAVVPFMGESITDGTLAKFLKQPGDRVEMDEPIAQIETDKVTIDVASPQAGVIQNLIAKEGETVEPGAKIAVISKSGEGVAQAASAEKAAAQPPPAEEKPSAEKQTPESEAAPAVKDKTPSEPPPTAKKPTSPPSKPMASEPQLPPKDRERRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSDYKDAFLEKHGVKLGLMSGFVKAAVSALQHQPVVNAVIDGDDIIYRDYIDISFAVGTKKGLVVPVIRNSERMNFAEIEKEISTLAKKANDGSISIDEMAGGTFTISNGGVYGSLLSTPIINPPQSAILGMHSIVNRPMVVGGNVVPRPMMYIALTYDHRLIDGREAVFFLRRIKDIVEDPRRLLLDI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of 3 enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).probableQ9D2G2
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of 3 enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).probableQ01205
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of 3 enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).probableP36957

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.3.-.-Acyltransferases.probable
2.3.1.-Transferring groups other than amino-acyl groups.probable
2.3.1.61Dihydrolipoyllysine-residue succinyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MAE, chain A
Confidence level:very confident
Coverage over the Query: 238-468
View the alignment between query and template
View the model in PyMOL
Template: 3DVA, chain I
Confidence level:very confident
Coverage over the Query: 199-223
View the alignment between query and template
View the model in PyMOL