Query         012144
Match_columns 470
No_of_seqs    26 out of 28
Neff          2.3 
Searched_HMMs 46136
Date          Thu Mar 28 23:31:11 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/012144.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/012144hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF09588 YqaJ:  YqaJ-like viral  42.3      16 0.00034   31.2   1.7   18  326-343   135-152 (152)
  2 PF01465 GRIP:  GRIP domain;  I  40.1      28  0.0006   26.3   2.5   25  266-291     9-33  (46)
  3 PF08844 DUF1815:  Domain of un  39.1      30 0.00065   31.0   2.9   51  336-393    13-65  (105)
  4 KOG1996 mRNA splicing factor [  30.6      50  0.0011   34.7   3.3   63   28-91     39-112 (378)
  5 PF00023 Ank:  Ankyrin repeat H  29.9      45 0.00098   22.1   2.0   21  159-179    12-32  (33)
  6 PF03765 CRAL_TRIO_N:  CRAL/TRI  25.7      77  0.0017   23.5   2.8   24  265-288    30-54  (55)
  7 PF14967 FAM70:  FAM70 protein   24.3   1E+02  0.0023   32.3   4.3   24   60-83    304-327 (327)
  8 PRK13855 type IV secretion sys  20.6 2.1E+02  0.0045   30.6   5.7   18   13-30     37-54  (376)
  9 PF06870 RNA_pol_I_A49:  A49-li  18.0      63  0.0014   32.5   1.3   32  275-307   329-380 (385)
 10 cd07633 BAR_OPHN1 The Bin/Amph  16.4      80  0.0017   31.1   1.5   54  305-358    18-79  (207)

No 1  
>PF09588 YqaJ:  YqaJ-like viral recombinase domain;  InterPro: IPR019080  This protein is found in many different bacterial species but is of viral origin. The protein forms an oligomer and functions as a processive alkaline exonuclease that digests linear double-stranded DNA in a Mg(2+)-dependent reaction, It has a preference for 5'-phosphorylated DNA ends. It thus forms part of the two-component SynExo viral recombinase functional unit []. ; PDB: 3SZ5_A 3SZ4_A 3SYY_A 3K93_A 1AVQ_A 3SM4_C 3SLP_A.
Probab=42.32  E-value=16  Score=31.18  Aligned_cols=18  Identities=39%  Similarity=0.464  Sum_probs=15.7

Q ss_pred             hhHHHHHHhHHhhhhhhh
Q 012144          326 LNAYIAGVQKQMLITNKQ  343 (470)
Q Consensus       326 l~sYvs~lQkQ~lITNlQ  343 (470)
                      -+.|...+|-||+||++|
T Consensus       135 p~~Y~~QvQ~qm~vtg~e  152 (152)
T PF09588_consen  135 PHYYYAQVQHQMAVTGAE  152 (152)
T ss_dssp             HHHHHHHHHHHHHHHT-S
T ss_pred             CHHHHHHHHHHHHHHCcC
Confidence            678999999999999975


No 2  
>PF01465 GRIP:  GRIP domain;  InterPro: IPR000237 The GRIP (golgin-97, RanBP2alpha,Imh1p and p230/golgin-245) domain [, , ] is found in many large coiled-coil proteins. It has been shown to be sufficient for targeting to the Golgi []. The GRIP domain contains a completely conserved tyrosine residue.; GO: 0005515 protein binding, 0000042 protein targeting to Golgi; PDB: 1R4A_H 1UPT_B.
Probab=40.06  E-value=28  Score=26.33  Aligned_cols=25  Identities=16%  Similarity=0.347  Sum_probs=18.7

Q ss_pred             hhhHHHHhhcCCCHHHHHHHHHhhcc
Q 012144          266 KGVAYSYLSSKLSAEAANSAFRILSA  291 (470)
Q Consensus       266 K~VVl~wLa~KL~~~~An~~~R~LS~  291 (470)
                      ||||++||..+= +++...+++.|+.
T Consensus         9 KNvl~~fl~~~~-~~~~~~llpvi~t   33 (46)
T PF01465_consen    9 KNVLLQFLESRE-PSEREQLLPVIAT   33 (46)
T ss_dssp             HHHHHHHHTTSS----HHHHHHHHHH
T ss_pred             HHHHHHHhcCCc-hhhHHHHHHHHHH
Confidence            899999999985 7788888887763


No 3  
>PF08844 DUF1815:  Domain of unknown function (DUF1815);  InterPro: IPR014943 This entry is about 100 amino acids in length and is functionally uncharacterised. 
Probab=39.08  E-value=30  Score=31.03  Aligned_cols=51  Identities=27%  Similarity=0.425  Sum_probs=32.8

Q ss_pred             HhhhhhhhHHHHHHHHhhhhhhcCccccccccc--ccccccccccccccccccccCCCCc
Q 012144          336 QMLITNKQAIICAAVFGSMLRKEGVMTNIYELC--DVDLKDFSIQAYGQQGCLLRSLPAD  393 (470)
Q Consensus       336 Q~lITNlQAl~CAt~lGs~Lqk~~V~~niY~LC--~I~LKDFSLQ~~~esGCLL~SLPsD  393 (470)
                      |-||-|||||      ++-|++.|+..--|. |  +-+...=|+-|.---|=+.|=|-||
T Consensus        13 ~DLVm~LqAL------a~~Le~rG~~AsCYt-C~dG~~~~~ASFmv~lg~~HliRFLVSd   65 (105)
T PF08844_consen   13 QDLVMSLQAL------AIVLERRGYLASCYT-CGDGRDMNSASFMVSLGDNHLIRFLVSD   65 (105)
T ss_pred             HHHHHHHHHH------HHHHHhCCceeEEEe-cCCCCCCCceeEEEEcCCCcEEEEEEec
Confidence            6799999997      788999999999885 6  4444444444332223344444443


No 4  
>KOG1996 consensus mRNA splicing factor [RNA processing and modification]
Probab=30.56  E-value=50  Score=34.74  Aligned_cols=63  Identities=25%  Similarity=0.312  Sum_probs=44.1

Q ss_pred             hhhhhhhhhccCCCCcccccccCCCCCCC-----CCCccccCCCCCCCCCCCCCCC------CCCCCCCCCCCCC
Q 012144           28 FQDVVALHNVLGPSHVSSTSELANPPTTG-----LFEPIEISPAVIPPYPYAGEPL------PPMYPTFPTTYEP   91 (470)
Q Consensus        28 ~q~v~~~~~~~~~~~~~~~~~l~~pp~~g-----lf~pieiSP~~~P~~~~P~~a~------~Pm~P~f~n~~~P   91 (470)
                      .|.-.+++++..|.-+-+.. +.++|++.     +|-||+-.|..-|-++.|.-+.      --.+|-|||.|+-
T Consensus        39 l~qq~~~r~l~kp~pvi~~~-~k~~~~s~~~qs~~~pp~~aap~~dpi~~g~~a~~~~~~v~~EYdPm~PNdye~  112 (378)
T KOG1996|consen   39 LQQQAARRKLVKPPPVIDLS-TKNRTISTAVQSVSFPPIRAAPVSDPISFGPKAATDEEHVKCEYDPMFPNDYEK  112 (378)
T ss_pred             cChHHHhccccCCCCceecc-cCCCCCCccccccccCcccccCccCcccccccccccccchhhhcCCCCcchHHH
Confidence            46677888888888877665 44555443     8999999999988888875431      1235666688754


No 5  
>PF00023 Ank:  Ankyrin repeat Hereditary spherocytosis;  InterPro: IPR002110  The ankyrin repeat is one of the most common protein-protein interaction motifs in nature. Ankyrin repeats are tandemly repeated modules of about 33 amino acids. They occur in a large number of functionally diverse proteins mainly from eukaryotes. The few known examples from prokaryotes and viruses may be the result of horizontal gene transfers []. The repeat has been found in proteins of diverse function such as transcriptional initiators, cell-cycle regulators, cytoskeletal, ion transporters and signal transducers. The ankyrin fold appears to be defined by its structure rather than its function since there is no specific sequence or structure which is universally recognised by it.  The conserved fold of the ankyrin repeat unit is known from several crystal and solution structures [, , , ]. Each repeat folds into a helix-loop-helix structure with a beta-hairpin/loop region projecting out from the helices at a 90o angle. The repeats stack together to form an L-shaped structure [, ].; GO: 0005515 protein binding; PDB: 1D9S_A 1NFI_F 1IKN_D 1WDY_A 1OT8_C 1QYM_A 1TR4_A 1UOH_A 1N11_A 1K1A_A ....
Probab=29.87  E-value=45  Score=22.12  Aligned_cols=21  Identities=24%  Similarity=0.362  Sum_probs=17.0

Q ss_pred             hhHHHHHHHHhhcCCcCCcCc
Q 012144          159 DCFSDILSILASRGANHTIPT  179 (470)
Q Consensus       159 ~C~SDi~~iL~s~GAn~~l~~  179 (470)
                      +--.|+.++|+++||+-++.+
T Consensus        12 ~~~~~~v~~Ll~~ga~~~~~d   32 (33)
T PF00023_consen   12 RGHPDIVKLLLKHGADINARD   32 (33)
T ss_dssp             TTCHHHHHHHHHTTSCTTCBC
T ss_pred             HHHHHHHHHHHHCcCCCCCCC
Confidence            346799999999999987653


No 6  
>PF03765 CRAL_TRIO_N:  CRAL/TRIO, N-terminal domain;  InterPro: IPR008273 This entry defines the N-terminal of various retinaldehyde/retinal-binding proteins that may be functional components of the visual cycle. Cellular retinaldehyde-binding protein (CRALBP) carries 11-cis-retinol or 11-cis-retinaldehyde as endogenous ligands and may function as a substrate carrier protein that modulates interaction of these retinoids with visual cycle enzymes []. The multidomain protein Trio binds the LAR transmembrane tyrosine phosphatase, contains a protein kinase domain, and has separate rac-specific and rho-specific guanine nucleotide exchange factor domains []. Trio is a multifunctional protein that integrates and amplifies signals involved in coordinating actin remodeling, which is necessary for cell migration and growth. Other members of the family are transfer proteins that include, guanine nucleotide exchange factor that may function as an effector of RAC1, phosphatidylinositol/phosphatidylcholine transfer protein that is required for the transport of secretory proteins from the golgi complex and alpha-tocopherol transfer protein that enhances the transfer of the ligand between separate membranes.; PDB: 1OIZ_A 1R5L_A 1OIP_A 3HX3_A 3HY5_A 1AUA_A 3Q8G_A 3B7Q_B 3B7Z_A 3B7N_A ....
Probab=25.67  E-value=77  Score=23.51  Aligned_cols=24  Identities=17%  Similarity=0.234  Sum_probs=20.2

Q ss_pred             chhhHHHHh-hcCCCHHHHHHHHHh
Q 012144          265 CKGVAYSYL-SSKLSAEAANSAFRI  288 (470)
Q Consensus       265 CK~VVl~wL-a~KL~~~~An~~~R~  288 (470)
                      -.++++||| |+|.+-+.|.+||+.
T Consensus        30 ~d~~llRFLRARkf~v~~A~~mL~~   54 (55)
T PF03765_consen   30 DDNFLLRFLRARKFDVEKAFKMLKK   54 (55)
T ss_dssp             SHHHHHHHHHHTTT-HHHHHHHHHH
T ss_pred             CHHHHHHHHHHccCCHHHHHHHHHh
Confidence            459999999 799999999999974


No 7  
>PF14967 FAM70:  FAM70 protein
Probab=24.31  E-value=1e+02  Score=32.25  Aligned_cols=24  Identities=42%  Similarity=0.759  Sum_probs=17.2

Q ss_pred             ccccCCCCCCCCCCCCCCCCCCCC
Q 012144           60 PIEISPAVIPPYPYAGEPLPPMYP   83 (470)
Q Consensus        60 pieiSP~~~P~~~~P~~a~~Pm~P   83 (470)
                      |-...|--.|.+|.|+|-|||-.|
T Consensus       304 p~~aPp~y~P~yf~PgEKPPPYaP  327 (327)
T PF14967_consen  304 PPNAPPRYAPPYFPPGEKPPPYAP  327 (327)
T ss_pred             CCCCCCCCCCCCCCCCCCCcCCCC
Confidence            444555567778889998888655


No 8  
>PRK13855 type IV secretion system protein VirB10; Provisional
Probab=20.56  E-value=2.1e+02  Score=30.62  Aligned_cols=18  Identities=22%  Similarity=0.329  Sum_probs=13.7

Q ss_pred             hhhHHHHHHHHHhhhhhh
Q 012144           13 SMCHAFLLFIAWLFSFQD   30 (470)
Q Consensus        13 ~~~~~~~lf~vwl~~~q~   30 (470)
                      -++-.|.+|++|+..-|+
T Consensus        37 ~~~~~~~~~~~w~~~~~~   54 (376)
T PRK13855         37 GLVLALSLSLIWLGGRSK   54 (376)
T ss_pred             HHHHHHHHHHHHhccCCC
Confidence            356678999999987654


No 9  
>PF06870 RNA_pol_I_A49:  A49-like RNA polymerase I associated factor ;  InterPro: IPR009668  Saccharomyces cerevisiae A49 is a specific subunit associated with RNA polymerase I (Pol I) in eukaryotes. Pol I maintains transcription activities in A49 deletion mutants. However, such mutants are deficient in transcription activity at low temperatures. Deletion analysis of the fusion yeast homologue indicates that only the C-terminal two thirds are required for function. Transcript analysis has demonstrated that A49 is maximising transcription of ribosomal DNA [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent, 0005634 nucleus; PDB: 3NFG_A 3NFH_B.
Probab=18.04  E-value=63  Score=32.48  Aligned_cols=32  Identities=44%  Similarity=0.687  Sum_probs=16.2

Q ss_pred             cCCCHHHHHHHHHhhccCccCc--------------------ccccCCCCchH
Q 012144          275 SKLSAEAANSAFRILSACKVNK--------------------VCPLDFKQPSE  307 (470)
Q Consensus       275 ~KL~~~~An~~~R~LS~CkVNk--------------------vCPL~F~~~s~  307 (470)
                      =|+++....+.||.| ||+|.+                    .=||.||.++.
T Consensus       329 Lkl~~~~l~~~~r~L-GC~v~~~~~~~~~~~~~~~~~~~a~L~~PL~fP~~~~  380 (385)
T PF06870_consen  329 LKLSPKKLTQYFREL-GCKVKKATEALGLSKSEAKTHKIATLKLPLKFPKPRR  380 (385)
T ss_dssp             HT--HHHHHHHHHHT-T-EEEE--HHHT--GGGGGGSEEEE------------
T ss_pred             hCCCHHHHHHHHHHh-CCEecccccccccccccccceeEEEEeCCCCCCCccc
Confidence            488999999999999 799988                    35888888764


No 10 
>cd07633 BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin-1. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Oligophrenin-1 (OPHN1) is a GTPase activating protein (GAP) with activity towards RhoA, Rac, and Cdc42, that is expressed in developing spinal cord and in adult brain areas with high plasticity. It plays a role in regulating the actin cystoskeleton as well as morphology changes in axons and dendrites, and may also function in modulating neuronal connectivity. Mutations in the OPHN1 gene causes X-linked mental retardation associated with cerebellar hypoplasia, lateral ventricle enlargement and epilepsy. OPHN1 contains an N-terminal BAR domain, followed by a Pleckstrin homology (PH) domain, and a Rho GAP domain. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Probab=16.42  E-value=80  Score=31.14  Aligned_cols=54  Identities=13%  Similarity=0.164  Sum_probs=46.2

Q ss_pred             chHHHHHhhccCCCCcchhhhhhHHHHHHh--HHhhhhhhh------HHHHHHHHhhhhhhc
Q 012144          305 PSEVIEACRNVAAPSPSCCSSLNAYIAGVQ--KQMLITNKQ------AIICAAVFGSMLRKE  358 (470)
Q Consensus       305 ~s~V~k~C~n~~~~~~sCC~al~sYvs~lQ--kQ~lITNlQ------Al~CAt~lGs~Lqk~  358 (470)
                      -.++||.|.+.+...-..+.|..+++.++|  ++-+|-.-+      .-.|-.-||..||.+
T Consensus        18 IkkliK~~~~li~a~K~~s~A~r~Fa~~L~df~f~~igd~~tdde~~I~~sL~~F~~~L~~i   79 (207)
T cd07633          18 IKDVIKDGNALISAIKEYSSAVQKFSQTLQSFQFDFIGDTLTDDEINIAESFKEFAELLQEV   79 (207)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCcccchHHHHHHHHHHHHHHHHHH
Confidence            357899999999999999999999999999  677777777      668888888888765


Done!