Query         012155
Match_columns 470
No_of_seqs    320 out of 1526
Neff          6.2 
Searched_HMMs 46136
Date          Thu Mar 28 23:38:01 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/012155.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/012155hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 3.2E-36 6.9E-41  268.2   6.4  126   49-193     1-129 (129)
  2 PF11498 Activator_LAG-3:  Tran  96.9 0.00025 5.4E-09   72.1   0.0    8  419-426   429-436 (468)
  3 KOG1883 Cofactor required for   84.2     2.2 4.8E-05   50.1   6.6   22  329-350  1430-1451(1517)
  4 KOG4369 RTK signaling protein   82.7    0.78 1.7E-05   53.8   2.3    9  143-151  1675-1683(2131)
  5 KOG1151 Tousled-like protein k  73.7     2.9 6.3E-05   45.1   3.2    6  241-246    30-35  (775)
  6 PF10571 UPF0547:  Uncharacteri  69.1     2.5 5.4E-05   27.5   0.9   14   27-40     11-24  (26)
  7 PF13248 zf-ribbon_3:  zinc-rib  68.1       3 6.5E-05   26.9   1.2   10   31-40      3-12  (26)
  8 PHA00692 hypothetical protein   68.0     1.9 4.1E-05   33.4   0.3   30   21-57     16-45  (74)
  9 PF13240 zinc_ribbon_2:  zinc-r  58.5     5.1 0.00011   25.2   0.9   11   32-42      1-11  (23)
 10 KOG1819 FYVE finger-containing  58.0     3.6 7.7E-05   44.5   0.2   25  312-336   566-590 (990)
 11 KOG4369 RTK signaling protein   57.5     7.9 0.00017   46.0   2.8   23  442-464  1946-1968(2131)
 12 PF03604 DNA_RNApol_7kD:  DNA d  53.3     7.2 0.00016   26.6   1.0   14   28-41     15-28  (32)
 13 COG1996 RPC10 DNA-directed RNA  50.7     6.3 0.00014   29.6   0.5   17   27-43     21-37  (49)
 14 PF04684 BAF1_ABF1:  BAF1 / ABF  45.5      19 0.00042   38.8   3.3    8  201-208   187-194 (496)
 15 KOG3648 Golgi apparatus protei  45.1      26 0.00055   39.4   4.2    6  453-459   110-115 (1179)
 16 smart00659 RPOLCX RNA polymera  44.1      10 0.00022   27.8   0.6   16   28-43     17-32  (44)
 17 PF08882 Acetone_carb_G:  Aceto  41.0      21 0.00045   31.3   2.2   32   31-62     75-106 (112)
 18 PF07282 OrfB_Zn_ribbon:  Putat  37.9      21 0.00045   27.9   1.7   26   29-54     27-55  (69)
 19 PRK12495 hypothetical protein;  37.4      17 0.00037   35.6   1.3   29   29-64     41-69  (226)
 20 PF07131 DUF1382:  Protein of u  34.2      35 0.00077   26.6   2.3   21   51-71     22-49  (61)
 21 KOG2991 Splicing regulator [RN  34.2      56  0.0012   32.9   4.3    8  306-313    48-55  (330)
 22 PF13717 zinc_ribbon_4:  zinc-r  32.8      20 0.00043   25.0   0.7   14   32-45      4-17  (36)
 23 PF00301 Rubredoxin:  Rubredoxi  32.1      15 0.00032   27.3  -0.1   25   32-56      3-29  (47)
 24 COG1327 Predicted transcriptio  31.8      16 0.00035   33.8   0.1   29   13-41      9-39  (156)
 25 PF12672 DUF3793:  Protein of u  31.5      22 0.00048   33.6   1.0   40   51-105    82-122 (176)
 26 PF09889 DUF2116:  Uncharacteri  29.5      28  0.0006   27.2   1.1   11   31-41      4-14  (59)
 27 cd00730 rubredoxin Rubredoxin;  28.9      40 0.00087   25.4   1.8   25   31-55      2-28  (50)
 28 PF09538 FYDLN_acid:  Protein o  28.7      25 0.00053   30.8   0.7   11   31-41     10-20  (108)
 29 TIGR01206 lysW lysine biosynth  27.6      36 0.00079   26.0   1.4   14   31-44      3-16  (54)
 30 PF03119 DNA_ligase_ZBD:  NAD-d  27.5      27 0.00059   23.0   0.6   15   32-46      1-15  (28)
 31 PRK06393 rpoE DNA-directed RNA  27.4      45 0.00097   26.5   1.9   36   29-67     16-51  (64)
 32 PF14255 Cys_rich_CPXG:  Cystei  27.0      23  0.0005   26.9   0.2   14   32-45      2-15  (52)
 33 PF05865 Cypo_polyhedrin:  Cypo  26.9      55  0.0012   30.7   2.7   27  144-170   141-168 (248)
 34 TIGR02098 MJ0042_CXXC MJ0042 f  26.8      24 0.00051   24.3   0.2   12   30-41     25-36  (38)
 35 PRK08351 DNA-directed RNA poly  26.6      51  0.0011   25.9   2.1   31   30-63     15-45  (61)
 36 COG4647 AcxC Acetone carboxyla  25.8      42 0.00091   30.3   1.7   37   31-70    121-157 (165)
 37 TIGR00155 pqiA_fam integral me  25.6      37 0.00079   36.3   1.5   33    9-42     13-45  (403)
 38 TIGR00244 transcriptional regu  25.2      28  0.0006   32.1   0.4   60   13-73      9-77  (147)
 39 PF14353 CpXC:  CpXC protein     24.7      34 0.00073   30.1   0.9   22   21-42     26-50  (128)
 40 PF07754 DUF1610:  Domain of un  24.7      33 0.00071   22.0   0.6   12   27-38     13-24  (24)
 41 PF09862 DUF2089:  Protein of u  24.2      36 0.00079   30.0   1.0   34   31-67     13-47  (113)
 42 PF14149 YhfH:  YhfH-like prote  23.1      20 0.00044   25.4  -0.7   17   25-41      8-24  (37)
 43 COG5624 TAF61 Transcription in  23.1      81  0.0018   33.7   3.4   13  431-443   290-302 (505)
 44 COG1885 Uncharacterized protei  22.6      44 0.00096   29.1   1.1   49   27-75     46-100 (115)
 45 COG2995 PqiA Uncharacterized p  22.4      47   0.001   35.4   1.5   36   11-47     20-55  (418)
 46 PF07960 CBP4:  CBP4;  InterPro  22.2      57  0.0012   29.4   1.8   17   55-71     29-49  (128)
 47 KOG4140 Nuclear protein Ataxin  22.0      76  0.0017   34.7   3.0   53   11-63     53-112 (659)
 48 PRK15103 paraquat-inducible me  21.8      45 0.00097   35.9   1.3   33    9-42     10-42  (419)
 49 PF08274 PhnA_Zn_Ribbon:  PhnA   21.0      32 0.00068   23.2  -0.1   14   28-41     17-30  (30)
 50 TIGR02300 FYDLN_acid conserved  20.4      45 0.00097   30.1   0.8   11   31-41     10-20  (129)
 51 PF12760 Zn_Tnp_IS1595:  Transp  20.0      65  0.0014   23.3   1.5   19   21-39      9-27  (46)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=3.2e-36  Score=268.20  Aligned_cols=126  Identities=40%  Similarity=0.699  Sum_probs=88.3

Q ss_pred             CCCCceeCCChHHHHH-HHHHhhhcCCCCCCCCccccccccccccCCCCCCCCCCCCCc-ccCCcceEEeecCCCCCCCC
Q 012155           49 LPAGVKFDPTDQELID-HLEAKVEAKDMVKPHPLIDEFIPTIEGEDGICYTHPEKLPGV-TRDGLSRHFFHRPSKAYTTG  126 (470)
Q Consensus        49 LPpG~RF~PTDeELI~-yL~~Ki~~~~~~~~~Pl~~~~I~~id~e~diy~~~Pw~Lp~~-~~~g~~~yFF~~~~~k~~~G  126 (470)
                      |||||||+|||+|||. ||++|+.+.++    |. .++|++    +|||++|||+||.. ...++.||||+++.+++.+|
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~----~~-~~~i~~----~Diy~~~P~~L~~~~~~~~~~~yFF~~~~~~~~~~   71 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPL----PC-EDVIHD----VDIYSAHPWELPAKFKGGDEEWYFFSPRKKKYPNG   71 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HH----CS--CHSEE------GGGS-GGGCHHHSSS-SSEEEEEEE--------
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCC----Cc-ccceee----cccCccChHHhhhhccCCCceEEEEEecccccCCc
Confidence            8999999999999997 69999998865    22 245654    47999999999942 23456899999998888999


Q ss_pred             CcccccccccccCCCCCcEEeecCCCceEEe-CCeeeeeeEEEeeEeecCCCCCCCCcCeEEEEEeeC
Q 012155          127 TRKRRKIQTECDLQGGETRWHKTGKTRPVMV-NGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYHLG  193 (470)
Q Consensus       127 ~R~~R~~~~~~~~~~g~G~Wk~tG~~k~V~~-~g~~vG~Kk~l~Fy~~~G~~~~g~kT~WvMhEY~L~  193 (470)
                      .|++|++        ++|+||.+|++++|.+ +|.+||+|++|+||.  |+.+++.+|+|+||||+|.
T Consensus        72 ~r~~R~~--------~~G~Wk~~g~~~~i~~~~g~~iG~k~~l~f~~--~~~~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   72 GRPNRVT--------GGGYWKSTGKEKPIKDPGGKVIGFKKTLVFYS--GKSPNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             --S-EEE--------TTEEEEEECEEEEEEE-TTCEEEEEEEEEEEE--SSTTS-EEEEEEEEEEEE-
T ss_pred             ccccccc--------cceEEeecccccccccccceeeeeEEEEEEEe--ccCCCCCcCCeEEEEEEeC
Confidence            9999964        5899999999999998 899999999999997  6777889999999999984


No 2  
>PF11498 Activator_LAG-3:  Transcriptional activator LAG-3;  InterPro: IPR021587  The C.elegans Notch pathway, involved in the control of growth, differentiation and patterning in animal development, relies on either of the receptors GLP-1 or LIN-12 []. Both these receptors promote signalling by the recruitment of LAG-3 to target promoters, where it then acts as a transcriptional activator. LAG-3 works as a ternary complex together with the DNA binding protein, LAG-1 []. ; PDB: 2FO1_D.
Probab=96.87  E-value=0.00025  Score=72.14  Aligned_cols=8  Identities=13%  Similarity=0.169  Sum_probs=0.0

Q ss_pred             CCCCcccc
Q 012155          419 GGRSASGL  426 (470)
Q Consensus       419 ~~~~~~g~  426 (470)
                      .+...+|.
T Consensus       429 hQn~~MGY  436 (468)
T PF11498_consen  429 HQNGGMGY  436 (468)
T ss_dssp             --------
T ss_pred             hhccCccc
Confidence            34444443


No 3  
>KOG1883 consensus Cofactor required for Sp1 transcriptional activation, subunit 3 [Transcription]
Probab=84.19  E-value=2.2  Score=50.15  Aligned_cols=22  Identities=27%  Similarity=0.360  Sum_probs=8.1

Q ss_pred             hhhHHHhHHHHhhhhhhhccch
Q 012155          329 HRQQQQQHQQQHQQQQQQQHHT  350 (470)
Q Consensus       329 qqqqqqqqQQQQQQQQQQQq~q  350 (470)
                      |.|++.|||++|||+++++|||
T Consensus      1430 q~q~t~q~q~~Qqq~~~~~qqq 1451 (1517)
T KOG1883|consen 1430 QMQDTSQHQTIQQQSNHPTQQQ 1451 (1517)
T ss_pred             hhhhhhHHHHHHHHhcchHHHH
Confidence            3333333333333333333333


No 4  
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms]
Probab=82.68  E-value=0.78  Score=53.83  Aligned_cols=9  Identities=11%  Similarity=0.254  Sum_probs=4.7

Q ss_pred             CcEEeecCC
Q 012155          143 ETRWHKTGK  151 (470)
Q Consensus       143 ~G~Wk~tG~  151 (470)
                      -|.|+..+.
T Consensus      1675 ~gq~~p~i~ 1683 (2131)
T KOG4369|consen 1675 PGQWAPHIG 1683 (2131)
T ss_pred             ccccccccc
Confidence            456655443


No 5  
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms]
Probab=73.71  E-value=2.9  Score=45.07  Aligned_cols=6  Identities=33%  Similarity=0.168  Sum_probs=2.3

Q ss_pred             CCCCCC
Q 012155          241 SGSCSS  246 (470)
Q Consensus       241 s~scss  246 (470)
                      ++.||.
T Consensus        30 sshpst   35 (775)
T KOG1151|consen   30 SSHPST   35 (775)
T ss_pred             CCCCcc
Confidence            334433


No 6  
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=69.10  E-value=2.5  Score=27.51  Aligned_cols=14  Identities=36%  Similarity=0.783  Sum_probs=9.2

Q ss_pred             ccCCCCCCCCCccc
Q 012155           27 LCGSKQCPGCGHKL   40 (470)
Q Consensus        27 ~~~~~~~~~~~~~~   40 (470)
                      +...+.||.|||.+
T Consensus        11 ~~~~~~Cp~CG~~F   24 (26)
T PF10571_consen   11 PESAKFCPHCGYDF   24 (26)
T ss_pred             hhhcCcCCCCCCCC
Confidence            44557777777765


No 7  
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=68.11  E-value=3  Score=26.87  Aligned_cols=10  Identities=40%  Similarity=1.225  Sum_probs=7.1

Q ss_pred             CCCCCCCccc
Q 012155           31 KQCPGCGHKL   40 (470)
Q Consensus        31 ~~~~~~~~~~   40 (470)
                      +.||+||..|
T Consensus         3 ~~Cp~Cg~~~   12 (26)
T PF13248_consen    3 MFCPNCGAEI   12 (26)
T ss_pred             CCCcccCCcC
Confidence            5688888755


No 8  
>PHA00692 hypothetical protein
Probab=68.00  E-value=1.9  Score=33.41  Aligned_cols=30  Identities=20%  Similarity=0.536  Sum_probs=19.9

Q ss_pred             hhhhhhccCCCCCCCCCccccCCCCCCCCCCCceeCC
Q 012155           21 KLEEHQLCGSKQCPGCGHKLEAKPDWLGLPAGVKFDP   57 (470)
Q Consensus        21 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~LPpG~RF~P   57 (470)
                      |..||-+|+--       +-++.-..+..||||||--
T Consensus        16 rvqehcmcarf-------hedrthyfveyppgfrfgg   45 (74)
T PHA00692         16 RVQEHCMCARF-------HEDRTHYFVEYPPGFRFGG   45 (74)
T ss_pred             hhHhhhhhhhh-------cccceeEeEecCCCccccc
Confidence            45566565543       2345567888999999964


No 9  
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=58.53  E-value=5.1  Score=25.21  Aligned_cols=11  Identities=45%  Similarity=1.283  Sum_probs=9.2

Q ss_pred             CCCCCCccccC
Q 012155           32 QCPGCGHKLEA   42 (470)
Q Consensus        32 ~~~~~~~~~~~   42 (470)
                      .||+||++|+.
T Consensus         1 ~Cp~CG~~~~~   11 (23)
T PF13240_consen    1 YCPNCGAEIED   11 (23)
T ss_pred             CCcccCCCCCC
Confidence            49999999964


No 10 
>KOG1819 consensus FYVE finger-containing proteins [General function prediction only]
Probab=58.00  E-value=3.6  Score=44.52  Aligned_cols=25  Identities=32%  Similarity=0.615  Sum_probs=11.4

Q ss_pred             ccccccCCCCCCCCccchhhHHHhH
Q 012155          312 EDIRDHHQRPHHHLAHDHRQQQQQH  336 (470)
Q Consensus       312 ~~~~~~~~~~~~~~~~~qqqqqqqq  336 (470)
                      +++.|.||+.|||+|||.+-+|+||
T Consensus       566 dshshrhhqrhhhhhhhrhphqhqh  590 (990)
T KOG1819|consen  566 DSHSHRHHQRHHHHHHHRHPHQHQH  590 (990)
T ss_pred             cccccchhhhccccccccCcchhcc
Confidence            3444444444444444444444443


No 11 
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms]
Probab=57.49  E-value=7.9  Score=46.03  Aligned_cols=23  Identities=30%  Similarity=0.467  Sum_probs=14.5

Q ss_pred             CCCCCCccccceeeccCCCCCCC
Q 012155          442 ESSMTNPQEAEWLKYSSFWPDPD  464 (470)
Q Consensus       442 ~~s~~~~~~~~~~~~~~~~~~~~  464 (470)
                      |++.+.+-.|..---.||.|+|-
T Consensus      1946 e~~~g~~~~~~s~~a~s~~~~~~ 1968 (2131)
T KOG4369|consen 1946 ESSTGAPGPTSSQLANSYYPSPS 1968 (2131)
T ss_pred             hccCCCCCCCCCccccCCCCCcc
Confidence            55666666666655667777753


No 12 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=53.29  E-value=7.2  Score=26.64  Aligned_cols=14  Identities=36%  Similarity=1.023  Sum_probs=10.6

Q ss_pred             cCCCCCCCCCcccc
Q 012155           28 CGSKQCPGCGHKLE   41 (470)
Q Consensus        28 ~~~~~~~~~~~~~~   41 (470)
                      -+...||.||++|-
T Consensus        15 ~~~irC~~CG~RIl   28 (32)
T PF03604_consen   15 GDPIRCPECGHRIL   28 (32)
T ss_dssp             SSTSSBSSSS-SEE
T ss_pred             CCcEECCcCCCeEE
Confidence            45589999999985


No 13 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=50.74  E-value=6.3  Score=29.63  Aligned_cols=17  Identities=29%  Similarity=0.677  Sum_probs=12.9

Q ss_pred             ccCCCCCCCCCccccCC
Q 012155           27 LCGSKQCPGCGHKLEAK   43 (470)
Q Consensus        27 ~~~~~~~~~~~~~~~~~   43 (470)
                      .-.-..||.||++|--+
T Consensus        21 ~~~~irCp~Cg~rIl~K   37 (49)
T COG1996          21 ETRGIRCPYCGSRILVK   37 (49)
T ss_pred             ccCceeCCCCCcEEEEe
Confidence            34458899999999654


No 14 
>PF04684 BAF1_ABF1:  BAF1 / ABF1 chromatin reorganising factor;  InterPro: IPR006774 ABF1 is a sequence-specific DNA binding protein involved in transcription activation, gene silencing and initiation of DNA replication. ABF1 is known to remodel chromatin, and it is proposed that it mediates its effects on transcription and gene expression by modifying local chromatin architecture []. These functions require a conserved stretch of 20 amino acids in the C-terminal region of ABF1 (amino acids 639 to 662 Saccharomyces cerevisiae (P14164 from SWISSPROT)) []. The N-terminal two thirds of the protein are necessary for DNA binding, and the N terminus (amino acids 9 to 91 in S. cerevisiae) is thought to contain a novel zinc-finger motif which may stabilise the protein structure [].; GO: 0003677 DNA binding, 0006338 chromatin remodeling, 0005634 nucleus
Probab=45.51  E-value=19  Score=38.83  Aligned_cols=8  Identities=38%  Similarity=0.717  Sum_probs=4.5

Q ss_pred             CCeEEEEE
Q 012155          201 GELVVSKI  208 (470)
Q Consensus       201 ~~~VLCKI  208 (470)
                      ..|||.||
T Consensus       187 ~~fvltki  194 (496)
T PF04684_consen  187 DKFVLTKI  194 (496)
T ss_pred             HHHHHhcc
Confidence            35566655


No 15 
>KOG3648 consensus Golgi apparatus protein (cysteine-rich fibroblast growth factor receptor) [Intracellular trafficking, secretion, and vesicular transport]
Probab=45.10  E-value=26  Score=39.44  Aligned_cols=6  Identities=33%  Similarity=0.822  Sum_probs=3.0

Q ss_pred             eeeccCC
Q 012155          453 WLKYSSF  459 (470)
Q Consensus       453 ~~~~~~~  459 (470)
                      | |..+|
T Consensus       110 ~-KLA~~  115 (1179)
T KOG3648|consen  110 W-KLAEE  115 (1179)
T ss_pred             c-cccch
Confidence            5 55444


No 16 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=44.07  E-value=10  Score=27.78  Aligned_cols=16  Identities=25%  Similarity=0.532  Sum_probs=12.7

Q ss_pred             cCCCCCCCCCccccCC
Q 012155           28 CGSKQCPGCGHKLEAK   43 (470)
Q Consensus        28 ~~~~~~~~~~~~~~~~   43 (470)
                      -+...||.||++|.-+
T Consensus        17 ~~~irC~~CG~rIlyK   32 (44)
T smart00659       17 KDVVRCRECGYRILYK   32 (44)
T ss_pred             CCceECCCCCceEEEE
Confidence            3558999999999733


No 17 
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=41.04  E-value=21  Score=31.35  Aligned_cols=32  Identities=34%  Similarity=0.700  Sum_probs=25.8

Q ss_pred             CCCCCCCccccCCCCCCCCCCCceeCCChHHH
Q 012155           31 KQCPGCGHKLEAKPDWLGLPAGVKFDPTDQEL   62 (470)
Q Consensus        31 ~~~~~~~~~~~~~~~~~~LPpG~RF~PTDeEL   62 (470)
                      -.||+||-.+|+.-.-++.||=+-|-|.-+-|
T Consensus        75 yyCP~Cgt~levE~~~Pg~P~~hD~epDid~f  106 (112)
T PF08882_consen   75 YYCPGCGTQLEVEAPPPGYPPIHDFEPDIDTF  106 (112)
T ss_pred             EECCCCcceeEEccCCCCCCceEecccCHHHH
Confidence            46999999999887777788888888865544


No 18 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=37.91  E-value=21  Score=27.88  Aligned_cols=26  Identities=31%  Similarity=0.722  Sum_probs=17.7

Q ss_pred             CCCCCCCCCccccC--CCCCCCCC-CCce
Q 012155           29 GSKQCPGCGHKLEA--KPDWLGLP-AGVK   54 (470)
Q Consensus        29 ~~~~~~~~~~~~~~--~~~~~~LP-pG~R   54 (470)
                      .|..||.||+..+.  ....+..| =|+.
T Consensus        27 TSq~C~~CG~~~~~~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   27 TSQTCPRCGHRNKKRRSGRVFTCPNCGFE   55 (69)
T ss_pred             CccCccCcccccccccccceEEcCCCCCE
Confidence            46899999999986  34444445 4555


No 19 
>PRK12495 hypothetical protein; Provisional
Probab=37.45  E-value=17  Score=35.62  Aligned_cols=29  Identities=28%  Similarity=0.534  Sum_probs=24.3

Q ss_pred             CCCCCCCCCccccCCCCCCCCCCCceeCCChHHHHH
Q 012155           29 GSKQCPGCGHKLEAKPDWLGLPAGVKFDPTDQELID   64 (470)
Q Consensus        29 ~~~~~~~~~~~~~~~~~~~~LPpG~RF~PTDeELI~   64 (470)
                      ....|+.||..|-      .| +|+.|.|+=++++.
T Consensus        41 sa~hC~~CG~PIp------a~-pG~~~Cp~CQ~~~~   69 (226)
T PRK12495         41 TNAHCDECGDPIF------RH-DGQEFCPTCQQPVT   69 (226)
T ss_pred             chhhcccccCccc------CC-CCeeECCCCCCccc
Confidence            3489999999994      46 79999999888775


No 20 
>PF07131 DUF1382:  Protein of unknown function (DUF1382);  InterPro: IPR009814 This entry is represented by Bacteriophage lambda, Xis. This entry overlaps with IPR009750, both representing lambda Xis. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several hypothetical Escherichia coli and Bacteriophage lambda-like proteins of around 60 residues in length. The function of this family is unknown.
Probab=34.21  E-value=35  Score=26.62  Aligned_cols=21  Identities=43%  Similarity=0.735  Sum_probs=15.8

Q ss_pred             CCceeCC----ChHHHHHH---HHHhhh
Q 012155           51 AGVKFDP----TDQELIDH---LEAKVE   71 (470)
Q Consensus        51 pG~RF~P----TDeELI~y---L~~Ki~   71 (470)
                      .|+||.|    ||+|+..+   |.+|+.
T Consensus        22 ~GIRFVpiPv~~dee~~~L~s~~~~kLe   49 (61)
T PF07131_consen   22 IGIRFVPIPVVTDEEFHTLSSQLSQKLE   49 (61)
T ss_pred             cCceeeccccccHHHHHHHHHHHHHHHH
Confidence            5999999    78888753   666654


No 21 
>KOG2991 consensus Splicing regulator [RNA processing and modification]
Probab=34.20  E-value=56  Score=32.87  Aligned_cols=8  Identities=0%  Similarity=-0.442  Sum_probs=3.1

Q ss_pred             CCCCCCcc
Q 012155          306 PAHGTCED  313 (470)
Q Consensus       306 ~~~~~~~~  313 (470)
                      +..+++..
T Consensus        48 ~~~tGm~~   55 (330)
T KOG2991|consen   48 GVRTGMIL   55 (330)
T ss_pred             CCccchhh
Confidence            33344433


No 22 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=32.77  E-value=20  Score=24.97  Aligned_cols=14  Identities=36%  Similarity=0.897  Sum_probs=8.0

Q ss_pred             CCCCCCccccCCCC
Q 012155           32 QCPGCGHKLEAKPD   45 (470)
Q Consensus        32 ~~~~~~~~~~~~~~   45 (470)
                      .||+|+.+.+.+++
T Consensus         4 ~Cp~C~~~y~i~d~   17 (36)
T PF13717_consen    4 TCPNCQAKYEIDDE   17 (36)
T ss_pred             ECCCCCCEEeCCHH
Confidence            46666666654433


No 23 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=32.06  E-value=15  Score=27.33  Aligned_cols=25  Identities=36%  Similarity=0.817  Sum_probs=16.5

Q ss_pred             CCCCCCccccCCC--CCCCCCCCceeC
Q 012155           32 QCPGCGHKLEAKP--DWLGLPAGVKFD   56 (470)
Q Consensus        32 ~~~~~~~~~~~~~--~~~~LPpG~RF~   56 (470)
                      .|+.||+-.+-..  ..-++|||..|.
T Consensus         3 ~C~~CgyvYd~~~Gd~~~~i~pGt~F~   29 (47)
T PF00301_consen    3 QCPVCGYVYDPEKGDPENGIPPGTPFE   29 (47)
T ss_dssp             EETTTSBEEETTTBBGGGTB-TT--GG
T ss_pred             CCCCCCEEEcCCcCCcccCcCCCCCHH
Confidence            5999998887553  346899998884


No 24 
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=31.83  E-value=16  Score=33.80  Aligned_cols=29  Identities=21%  Similarity=0.534  Sum_probs=21.5

Q ss_pred             CcchhhhhhhhhhhccC--CCCCCCCCcccc
Q 012155           13 SSSDLIDAKLEEHQLCG--SKQCPGCGHKLE   41 (470)
Q Consensus        13 ~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~   41 (470)
                      ..+.+||+|+-|....-  -+.|++||+.+-
T Consensus         9 ~~tkViDSR~~edg~aIRRRReC~~C~~RFT   39 (156)
T COG1327           9 EDTKVIDSRPAEEGNAIRRRRECLECGERFT   39 (156)
T ss_pred             CCCeeeecccccccchhhhhhcccccccccc
Confidence            35678999988854222  289999999984


No 25 
>PF12672 DUF3793:  Protein of unknown function (DUF3793);  InterPro: IPR024523 This family of bacterial proteins is functionally uncharacterised. The proteins in this family contain two conserved sequence motifs: PHE and LGYP.
Probab=31.54  E-value=22  Score=33.58  Aligned_cols=40  Identities=25%  Similarity=0.339  Sum_probs=24.8

Q ss_pred             CCceeCCChHHHHHHHHHhhhcCCCCCCCCccccccccccccCCCC-CCCCCCCCC
Q 012155           51 AGVKFDPTDQELIDHLEAKVEAKDMVKPHPLIDEFIPTIEGEDGIC-YTHPEKLPG  105 (470)
Q Consensus        51 pG~RF~PTDeELI~yL~~Ki~~~~~~~~~Pl~~~~I~~id~e~diy-~~~Pw~Lp~  105 (470)
                      -|| ..-+-+++|.+|..|+....+          -+    |++|+ +++..|.-|
T Consensus        82 ~GY-~~~~~~~~L~~L~~R~~~~~F----------PH----EIGiFLGYPleDV~G  122 (176)
T PF12672_consen   82 YGY-PDSSLEDCLEHLKKRFESGEF----------PH----EIGIFLGYPLEDVKG  122 (176)
T ss_pred             CCc-CCCCHHHHHHHHHHHhcCCCC----------Cc----hhHhccCCCHHHHHH
Confidence            477 556667777899988854443          12    23454 667777644


No 26 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=29.48  E-value=28  Score=27.20  Aligned_cols=11  Identities=45%  Similarity=1.229  Sum_probs=9.6

Q ss_pred             CCCCCCCcccc
Q 012155           31 KQCPGCGHKLE   41 (470)
Q Consensus        31 ~~~~~~~~~~~   41 (470)
                      +.||.||..|+
T Consensus         4 kHC~~CG~~Ip   14 (59)
T PF09889_consen    4 KHCPVCGKPIP   14 (59)
T ss_pred             CcCCcCCCcCC
Confidence            78999998884


No 27 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=28.87  E-value=40  Score=25.36  Aligned_cols=25  Identities=28%  Similarity=0.574  Sum_probs=19.4

Q ss_pred             CCCCCCCccccCC--CCCCCCCCCcee
Q 012155           31 KQCPGCGHKLEAK--PDWLGLPAGVKF   55 (470)
Q Consensus        31 ~~~~~~~~~~~~~--~~~~~LPpG~RF   55 (470)
                      .+|..||+-.+-.  ...-++|||-.|
T Consensus         2 y~C~~CgyiYd~~~Gd~~~~i~pGt~f   28 (50)
T cd00730           2 YECRICGYIYDPAEGDPDEGIPPGTPF   28 (50)
T ss_pred             cCCCCCCeEECCCCCCcccCcCCCCCH
Confidence            4799999988844  345688999887


No 28 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=28.70  E-value=25  Score=30.75  Aligned_cols=11  Identities=45%  Similarity=1.271  Sum_probs=9.6

Q ss_pred             CCCCCCCcccc
Q 012155           31 KQCPGCGHKLE   41 (470)
Q Consensus        31 ~~~~~~~~~~~   41 (470)
                      +.||.||.+|-
T Consensus        10 R~Cp~CG~kFY   20 (108)
T PF09538_consen   10 RTCPSCGAKFY   20 (108)
T ss_pred             ccCCCCcchhc
Confidence            88999999884


No 29 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=27.64  E-value=36  Score=26.04  Aligned_cols=14  Identities=36%  Similarity=0.990  Sum_probs=10.7

Q ss_pred             CCCCCCCccccCCC
Q 012155           31 KQCPGCGHKLEAKP   44 (470)
Q Consensus        31 ~~~~~~~~~~~~~~   44 (470)
                      ..||.||..|+...
T Consensus         3 ~~CP~CG~~iev~~   16 (54)
T TIGR01206         3 FECPDCGAEIELEN   16 (54)
T ss_pred             cCCCCCCCEEecCC
Confidence            37999999996543


No 30 
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=27.48  E-value=27  Score=22.99  Aligned_cols=15  Identities=40%  Similarity=0.776  Sum_probs=8.1

Q ss_pred             CCCCCCccccCCCCC
Q 012155           32 QCPGCGHKLEAKPDW   46 (470)
Q Consensus        32 ~~~~~~~~~~~~~~~   46 (470)
                      .||.||.+|....+.
T Consensus         1 ~CP~C~s~l~~~~~e   15 (28)
T PF03119_consen    1 TCPVCGSKLVREEGE   15 (28)
T ss_dssp             B-TTT--BEEE-CCT
T ss_pred             CcCCCCCEeEcCCCC
Confidence            499999999865553


No 31 
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=27.41  E-value=45  Score=26.52  Aligned_cols=36  Identities=19%  Similarity=0.540  Sum_probs=27.2

Q ss_pred             CCCCCCCCCccccCCCCCCCCCCCceeCCChHHHHHHHH
Q 012155           29 GSKQCPGCGHKLEAKPDWLGLPAGVKFDPTDQELIDHLE   67 (470)
Q Consensus        29 ~~~~~~~~~~~~~~~~~~~~LPpG~RF~PTDeELI~yL~   67 (470)
                      +...||.||-. +.+.+|-||=.  -.+|.+.|+...|.
T Consensus        16 ~~~~Cp~Cgs~-~~S~~w~G~v~--i~dPe~S~vAk~~~   51 (64)
T PRK06393         16 PEKTCPVHGDE-KTTTEWFGFLI--ITEPEGSAIAKRAG   51 (64)
T ss_pred             CCCcCCCCCCC-cCCcCcceEEE--EECCchhHHHHHhC
Confidence            34589999996 66788887742  46999999877663


No 32 
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=27.02  E-value=23  Score=26.89  Aligned_cols=14  Identities=50%  Similarity=0.982  Sum_probs=11.3

Q ss_pred             CCCCCCccccCCCC
Q 012155           32 QCPGCGHKLEAKPD   45 (470)
Q Consensus        32 ~~~~~~~~~~~~~~   45 (470)
                      .||.||+.|+...|
T Consensus         2 ~CPyCge~~~~~iD   15 (52)
T PF14255_consen    2 QCPYCGEPIEILID   15 (52)
T ss_pred             CCCCCCCeeEEEEe
Confidence            69999999986544


No 33 
>PF05865 Cypo_polyhedrin:  Cypovirus polyhedrin protein;  InterPro: IPR008464 This family consists of several Cypovirus polyhedrin proteins. Polyhedrin is known to form a crystalline matrix (polyhedra) in infected insect cells [].; PDB: 2OH7_A 2OH5_A 2OH6_A.
Probab=26.91  E-value=55  Score=30.74  Aligned_cols=27  Identities=30%  Similarity=0.543  Sum_probs=17.7

Q ss_pred             cEEeecC-CCceEEeCCeeeeeeEEEee
Q 012155          144 TRWHKTG-KTRPVMVNGKQKGCKKILVL  170 (470)
Q Consensus       144 G~Wk~tG-~~k~V~~~g~~vG~Kk~l~F  170 (470)
                      --|.+|| +-+.|..+|++||+...|.+
T Consensus       141 hpweatgikyrki~~dgeivgyshyfel  168 (248)
T PF05865_consen  141 HPWEATGIKYRKIHRDGEIVGYSHYFEL  168 (248)
T ss_dssp             -S-B--GGG-EEEEETTEEEEEEEEEE-
T ss_pred             CCccccCceEEEeeccceEeeeeeeeec
Confidence            4699999 46778899999999887754


No 34 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=26.77  E-value=24  Score=24.34  Aligned_cols=12  Identities=33%  Similarity=0.769  Sum_probs=7.9

Q ss_pred             CCCCCCCCcccc
Q 012155           30 SKQCPGCGHKLE   41 (470)
Q Consensus        30 ~~~~~~~~~~~~   41 (470)
                      ...||+||+.|.
T Consensus        25 ~v~C~~C~~~~~   36 (38)
T TIGR02098        25 KVRCGKCGHVWY   36 (38)
T ss_pred             EEECCCCCCEEE
Confidence            356777777664


No 35 
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=26.62  E-value=51  Score=25.92  Aligned_cols=31  Identities=23%  Similarity=0.642  Sum_probs=23.9

Q ss_pred             CCCCCCCCccccCCCCCCCCCCCceeCCChHHHH
Q 012155           30 SKQCPGCGHKLEAKPDWLGLPAGVKFDPTDQELI   63 (470)
Q Consensus        30 ~~~~~~~~~~~~~~~~~~~LPpG~RF~PTDeELI   63 (470)
                      ...||+||-.- -+.+|.+|=.  -.+|...|+.
T Consensus        15 ~~~CP~Cgs~~-~T~~W~G~vi--I~dPe~S~IA   45 (61)
T PRK08351         15 EDRCPVCGSRD-LSDEWFDLVI--IIDVENSRIA   45 (61)
T ss_pred             CCcCCCCcCCc-cccccccEEE--EeCCcHhHHH
Confidence            34799999843 5679998654  7899988887


No 36 
>COG4647 AcxC Acetone carboxylase, gamma subunit [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=25.85  E-value=42  Score=30.32  Aligned_cols=37  Identities=27%  Similarity=0.448  Sum_probs=29.3

Q ss_pred             CCCCCCCccccCCCCCCCCCCCceeCCChHHHHHHHHHhh
Q 012155           31 KQCPGCGHKLEAKPDWLGLPAGVKFDPTDQELIDHLEAKV   70 (470)
Q Consensus        31 ~~~~~~~~~~~~~~~~~~LPpG~RF~PTDeELI~yL~~Ki   70 (470)
                      -.||.||+-.|..-..++.|.=--|.|.   |-.|++.++
T Consensus       121 ficpecg~l~eveaaap~ypivhdfepd---legfyrdwl  157 (165)
T COG4647         121 FICPECGILHEVEAAAPGYPIVHDFEPD---LEGFYRDWL  157 (165)
T ss_pred             hhCccccceeeeccCCCCCceeccCCcc---HHHHHHHHc
Confidence            5799999999988888888888899995   334666553


No 37 
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=25.65  E-value=37  Score=36.30  Aligned_cols=33  Identities=24%  Similarity=0.417  Sum_probs=23.8

Q ss_pred             ccccCcchhhhhhhhhhhccCCCCCCCCCccccC
Q 012155            9 GTNISSSDLIDAKLEEHQLCGSKQCPGCGHKLEA   42 (470)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   42 (470)
                      ...|..++++- ++.....-+.-.||+||+.+-+
T Consensus        13 ~~~C~~Cd~l~-~~~~l~~g~~a~CpRCg~~L~~   45 (403)
T TIGR00155        13 HILCSQCDMLV-ALPRIESGQKAACPRCGTTLTV   45 (403)
T ss_pred             eeeCCCCCCcc-cccCCCCCCeeECCCCCCCCcC
Confidence            34799999886 4444445556789999999954


No 38 
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=25.18  E-value=28  Score=32.12  Aligned_cols=60  Identities=18%  Similarity=0.382  Sum_probs=33.3

Q ss_pred             Ccchhhhhhhhhhhcc--CCCCCCCCCccccCCCCCCCC-CCCc-----eeCCChHHHHHH-HHHhhhcC
Q 012155           13 SSSDLIDAKLEEHQLC--GSKQCPGCGHKLEAKPDWLGL-PAGV-----KFDPTDQELIDH-LEAKVEAK   73 (470)
Q Consensus        13 ~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~L-PpG~-----RF~PTDeELI~y-L~~Ki~~~   73 (470)
                      ..+.+||+|+-+....  --+.|+.||+.+- +-+.+.+ |+=+     +-.|=|.+=|.- |.+-+..+
T Consensus         9 ~dtkViDSR~~~dg~~IRRRReC~~C~~RFT-TyErve~~~l~ViKkdG~re~Fdr~Kl~~gl~~Ac~KR   77 (147)
T TIGR00244         9 HNTRVLDSRLVEDGQSIRRRRECLECHERFT-TFERAELLPPTVIKQDGVREPFNREKLLRGMVRACEKR   77 (147)
T ss_pred             CCCEeeeccccCCCCeeeecccCCccCCccc-eeeeccccccEEEcCCCCCCCCCHHHHHHHHHHHhcCC
Confidence            4567889888764422  2289999999994 3343333 2212     344555554443 44433333


No 39 
>PF14353 CpXC:  CpXC protein
Probab=24.74  E-value=34  Score=30.13  Aligned_cols=22  Identities=50%  Similarity=0.954  Sum_probs=15.5

Q ss_pred             hhhhhhccCC---CCCCCCCccccC
Q 012155           21 KLEEHQLCGS---KQCPGCGHKLEA   42 (470)
Q Consensus        21 ~~~~~~~~~~---~~~~~~~~~~~~   42 (470)
                      .|.|..+.++   ..||.||+.+--
T Consensus        26 ~l~e~il~g~l~~~~CP~Cg~~~~~   50 (128)
T PF14353_consen   26 ELKEKILDGSLFSFTCPSCGHKFRL   50 (128)
T ss_pred             HHHHHHHcCCcCEEECCCCCCceec
Confidence            3445555555   889999999853


No 40 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=24.70  E-value=33  Score=22.01  Aligned_cols=12  Identities=33%  Similarity=0.833  Sum_probs=8.7

Q ss_pred             ccCCCCCCCCCc
Q 012155           27 LCGSKQCPGCGH   38 (470)
Q Consensus        27 ~~~~~~~~~~~~   38 (470)
                      ....-.||+||.
T Consensus        13 ~~v~f~CPnCG~   24 (24)
T PF07754_consen   13 QAVPFPCPNCGF   24 (24)
T ss_pred             cCceEeCCCCCC
Confidence            344578999994


No 41 
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=24.23  E-value=36  Score=30.00  Aligned_cols=34  Identities=29%  Similarity=0.724  Sum_probs=23.4

Q ss_pred             CCCCCCCccccCCCCCCCCCCCceeCCChHHHHH-HHH
Q 012155           31 KQCPGCGHKLEAKPDWLGLPAGVKFDPTDQELID-HLE   67 (470)
Q Consensus        31 ~~~~~~~~~~~~~~~~~~LPpG~RF~PTDeELI~-yL~   67 (470)
                      ..|++|+-.|++...   ||.=.+..+-|.+.|. |++
T Consensus        13 l~C~~C~t~i~G~F~---l~~~~~L~~E~~~Fi~~Fi~   47 (113)
T PF09862_consen   13 LKCPSCGTEIEGEFE---LPWFARLSPEQLEFIKLFIK   47 (113)
T ss_pred             EEcCCCCCEEEeeec---cchhhcCCHHHHHHHHHHHH
Confidence            579999999987544   6655566666666665 653


No 42 
>PF14149 YhfH:  YhfH-like protein
Probab=23.10  E-value=20  Score=25.39  Aligned_cols=17  Identities=29%  Similarity=0.735  Sum_probs=13.8

Q ss_pred             hhccCCCCCCCCCcccc
Q 012155           25 HQLCGSKQCPGCGHKLE   41 (470)
Q Consensus        25 ~~~~~~~~~~~~~~~~~   41 (470)
                      -+.-..+.|+.||..|+
T Consensus         8 frnLp~K~C~~CG~~i~   24 (37)
T PF14149_consen    8 FRNLPPKKCTECGKEIE   24 (37)
T ss_pred             HHhCCCcccHHHHHHHH
Confidence            34667799999999986


No 43 
>COG5624 TAF61 Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA) [Transcription]
Probab=23.07  E-value=81  Score=33.74  Aligned_cols=13  Identities=23%  Similarity=0.503  Sum_probs=5.6

Q ss_pred             cCCCCCCCCCCCC
Q 012155          431 MGCTSSSDIKEES  443 (470)
Q Consensus       431 ~~~ts~~~~~~~~  443 (470)
                      ..|.+++.++++.
T Consensus       290 ~~~~~~e~s~~~~  302 (505)
T COG5624         290 FRCPSPESSRGEP  302 (505)
T ss_pred             ccCCCchhccccc
Confidence            3344444444443


No 44 
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=22.58  E-value=44  Score=29.05  Aligned_cols=49  Identities=24%  Similarity=0.512  Sum_probs=27.8

Q ss_pred             ccCCCCCCCCCccccCC-----CCCCCCCCCc-eeCCChHHHHHHHHHhhhcCCC
Q 012155           27 LCGSKQCPGCGHKLEAK-----PDWLGLPAGV-KFDPTDQELIDHLEAKVEAKDM   75 (470)
Q Consensus        27 ~~~~~~~~~~~~~~~~~-----~~~~~LPpG~-RF~PTDeELI~yL~~Ki~~~~~   75 (470)
                      .-++..||-||..+|.-     ...++|---. -|+-.-.|=..-..++..|+.+
T Consensus        46 e~G~t~CP~Cg~~~e~~fvva~~aLVgl~l~mkVFNaes~EHA~RIAK~eIGk~L  100 (115)
T COG1885          46 EVGSTSCPKCGEPFESAFVVANTALVGLILSMKVFNAESDEHAERIAKAEIGKAL  100 (115)
T ss_pred             ecccccCCCCCCccceeEEEecceeEEEEEEEEEecCCCHHHHHHHHHHHHhhHh
Confidence            56889999999999732     2222222112 3776655554444444444444


No 45 
>COG2995 PqiA Uncharacterized paraquat-inducible protein A [Function unknown]
Probab=22.44  E-value=47  Score=35.36  Aligned_cols=36  Identities=31%  Similarity=0.581  Sum_probs=22.0

Q ss_pred             ccCcchhhhhhhhhhhccCCCCCCCCCccccCCCCCC
Q 012155           11 NISSSDLIDAKLEEHQLCGSKQCPGCGHKLEAKPDWL   47 (470)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   47 (470)
                      -|+.++++-. +-+..-..+-.||+|||+|-+..+|.
T Consensus        20 ~C~eCd~~~~-~P~l~~~q~A~CPRC~~~l~~~~~~s   55 (418)
T COG2995          20 LCPECDMLVS-LPRLDSGQSAYCPRCGHTLTRGGDWS   55 (418)
T ss_pred             cCCCCCceec-cccCCCCCcccCCCCCCccccCCCCC
Confidence            3444444332 22333445689999999998766664


No 46 
>PF07960 CBP4:  CBP4;  InterPro: IPR012420 The CBP4 gene in Saccharomyces cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase [, ]. This family appears to be fungal specific. 
Probab=22.15  E-value=57  Score=29.44  Aligned_cols=17  Identities=29%  Similarity=0.432  Sum_probs=12.5

Q ss_pred             eCCChHHHHH-H---HHHhhh
Q 012155           55 FDPTDQELID-H---LEAKVE   71 (470)
Q Consensus        55 F~PTDeELI~-y---L~~Ki~   71 (470)
                      -.||||||+. |   |+++..
T Consensus        29 ~tPTeEeL~~r~sPELrkr~~   49 (128)
T PF07960_consen   29 TTPTEEELFKRYSPELRKRYL   49 (128)
T ss_pred             cCCCHHHHHHhcCHHHHHHHH
Confidence            4799999996 5   655544


No 47 
>KOG4140 consensus Nuclear protein Ataxin-7 [Chromatin structure and dynamics]
Probab=22.01  E-value=76  Score=34.69  Aligned_cols=53  Identities=17%  Similarity=0.105  Sum_probs=36.3

Q ss_pred             ccCcchhhhhhhhhhhccC--C-CCCCCCCccccCC----CCCCCCCCCceeCCChHHHH
Q 012155           11 NISSSDLIDAKLEEHQLCG--S-KQCPGCGHKLEAK----PDWLGLPAGVKFDPTDQELI   63 (470)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~~--~-~~~~~~~~~~~~~----~~~~~LPpG~RF~PTDeELI   63 (470)
                      +.+..-+-++++.|..+--  | ..|--|+.-..-+    .+..++=.|--|.|.-+|+=
T Consensus        53 ~L~K~~~a~a~v~e~~~~~~~~~~~~E~~~~p~~~T~Ild~~~~~~c~G~~~~p~~d~~D  112 (659)
T KOG4140|consen   53 ALSKSAAAMATVGERRPLPSSWNLWVEASKLPGKDTTILDEEVMGLCRGDMFCPAHDDFD  112 (659)
T ss_pred             ccccccccccccccCCCCCchhhhhhHhhcCccccceeccHhhhccccccccCCCCCcch
Confidence            4455566778888887433  3 7899999877532    33567778999999766553


No 48 
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=21.83  E-value=45  Score=35.86  Aligned_cols=33  Identities=21%  Similarity=0.404  Sum_probs=24.0

Q ss_pred             ccccCcchhhhhhhhhhhccCCCCCCCCCccccC
Q 012155            9 GTNISSSDLIDAKLEEHQLCGSKQCPGCGHKLEA   42 (470)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   42 (470)
                      .+.|..++++- ++.....-+.-.||+||+.+.+
T Consensus        10 ~~~C~~Cd~l~-~~~~l~~g~~a~CpRCg~~L~~   42 (419)
T PRK15103         10 HILCPQCDMLV-ALPRLEHGQKAACPRCGTTLTV   42 (419)
T ss_pred             cccCCCCCcee-ecCCCCCCCeeECCCCCCCCcC
Confidence            35799999886 4444444556789999999953


No 49 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=20.97  E-value=32  Score=23.22  Aligned_cols=14  Identities=36%  Similarity=0.840  Sum_probs=10.2

Q ss_pred             cCCCCCCCCCcccc
Q 012155           28 CGSKQCPGCGHKLE   41 (470)
Q Consensus        28 ~~~~~~~~~~~~~~   41 (470)
                      ...-+||.|+|.++
T Consensus        17 ~~~~vCp~C~~ew~   30 (30)
T PF08274_consen   17 GELLVCPECGHEWN   30 (30)
T ss_dssp             SSSEEETTTTEEE-
T ss_pred             CCEEeCCcccccCC
Confidence            34478999999873


No 50 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=20.38  E-value=45  Score=30.06  Aligned_cols=11  Identities=36%  Similarity=0.869  Sum_probs=9.8

Q ss_pred             CCCCCCCcccc
Q 012155           31 KQCPGCGHKLE   41 (470)
Q Consensus        31 ~~~~~~~~~~~   41 (470)
                      +.||+||.++-
T Consensus        10 r~Cp~cg~kFY   20 (129)
T TIGR02300        10 RICPNTGSKFY   20 (129)
T ss_pred             ccCCCcCcccc
Confidence            88999999984


No 51 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=20.04  E-value=65  Score=23.33  Aligned_cols=19  Identities=37%  Similarity=0.632  Sum_probs=14.1

Q ss_pred             hhhhhhccCCCCCCCCCcc
Q 012155           21 KLEEHQLCGSKQCPGCGHK   39 (470)
Q Consensus        21 ~~~~~~~~~~~~~~~~~~~   39 (470)
                      -|++.+-..-.+||.||+.
T Consensus         9 ~l~~~RW~~g~~CP~Cg~~   27 (46)
T PF12760_consen    9 YLEEIRWPDGFVCPHCGST   27 (46)
T ss_pred             HHHHhcCCCCCCCCCCCCe
Confidence            5667774455889999985


Done!