Citrus Sinensis ID: 012189

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------47
MNPMGSGELKYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSLDMDNSSISNIKSSFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSIKKSTSEAVDNVVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVSGRRRYNLLLLLALVRLFIGGWLHTMMLKILSKM
cccccccccEEEcccccccccHHHcHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccEEEEEcccHHHHHHcccccccccccccEEEEEcccccccHHHHccccccHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHccccccEEcHHHHHHHHHccccccccccccHHHHcHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccccccEEEEEEccccccccHHHHHHHHHHHccccccccccccccEEEEEEcccccccccccccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccEEEEEEccHHHHHHcccccccHHHHccEEEEccHHcccHHHHHHcccHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHcccccEEEEcccHHHHHHccccEEcccccHHHHHHcHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mnpmgsgelkyiedssvpaveEGLVDFADRMTENadklmapvepkttlaieltpenptttfdsldmdnssisniKSSFDDFLAGvnesfsssmikgenavKSSLDTITSSLTSIKKSTSEAVDNVVSRVFSSidqtggsagskltnFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYgttkeslppeIRDALNLYEDRAvklwrpvgsaLQQVSVAIEGLerslgfdpndpivPFVVFLGTSATLWIFYWWWtyggysgdlspkstLELLRGKENAVLIDVRhedlrerdgipdlrrgarFRYASvylpevggSVKKLLRGGRELDDTLTAAVIRNLKivqdrskvivmdadgtrskGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILedinsspvqflgfgvsgRRRYNLLLLLALVRLFIGGWLHTMMLKILSKM
mnpmgsgelkyiedssvpAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSLDMDNSSISNIKSSFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSikkstseavdnVVSRVFSsidqtggsagskLTNFSTDLKEASSKATVAAVDVLRNTIVALeesmtngaSFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAvlidvrhedlrerdgipdlrrgarfryasvylpevggsvkkllrggreldDTLTAAVIrnlkivqdrskvivmdadgtrskgiarSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVSGRRRYNLLLLLALVRLFIGGWLHTMMLKILSKM
MNPMGSGELKYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSLDMDNSSISNIKSSFDDFLAGVNESFSSSMIKGENAVkssldtitssltsikkstsEAVDNVVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVSGrrrynlllllalvrlFIGGWLHTMMLKILSKM
*************************************************************************************************************************************************************ATVAAVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVSGRRRYNLLLLLALVRLFIGGWLHTMMLKIL***
**************SSVPAVEEGLVD************************************************************************AVKSSLDTITSSLTSIKKSTSEAVDNVVSRVFSSI**************************VAAVDVLRNTI************************************EDR*VKLWRPVGSALQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVSGRRRYNLLLLLALVRLFIGGWLHTMMLKILS**
********LKYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSLDMDNSSISNIKSSFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSIKKSTSEAVDNVVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVSGRRRYNLLLLLALVRLFIGGWLHTMMLKILSKM
*****SGELKYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPE*********************SFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSIKKSTSEAVDNVVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVSGRRRYNLLLLLALVRLFIGGWLHTMMLKILSK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPMGSGELKYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSLDMDNSSISNIKSSFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSIKKSTSEAVDNVVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVSGRRRYNLLLLLALVRLFIGGWLHTMMLKILSKM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query468 2.2.26 [Sep-21-2011]
Q9FN48387 Calcium sensing receptor, no no 0.373 0.452 0.296 2e-15
>sp|Q9FN48|CAS_ARATH Calcium sensing receptor, chloroplastic OS=Arabidopsis thaliana GN=CAS PE=1 SV=1 Back     alignment and function desciption
 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 94/189 (49%), Gaps = 14/189 (7%)

Query: 222 QQVSVAIEGLE--RSLGFDPNDPIVPFVVFLGTSATLWIFYWW--------WTYGGYSGD 271
           QQ S AIE  +   S   D      P V+ +   A    +           + + GY GD
Sbjct: 161 QQTSKAIEDAKPIASSTMDTISSADPSVIVVAAGAAFLAYLLLPPVFSAISFNFRGYKGD 220

Query: 272 LSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLR 331
           L+P  TL+LL  K N +++D+R E  +E+ GIP L   A+ R  S+ L E+   VK ++R
Sbjct: 221 LTPAQTLDLLCTK-NYLMVDIRSEKDKEKAGIPRLPSNAKNRVISIPLEELPNKVKGIVR 279

Query: 332 GGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGF-- 389
             + ++  + A  I  LK +   S +I++D+    +K +A++L+ LG    ++V  GF  
Sbjct: 280 NSKRVEAEIAALKISYLKKINKGSNIIILDSYTDSAKIVAKTLKVLGYKNCYIVTDGFSG 339

Query: 390 -QSWVKEGL 397
            + W++  L
Sbjct: 340 GRGWLQSRL 348
Modulates cytoplasmic Ca(2+) concentration and is crucial for proper stomatal regulation in response to elevated levels of external Ca(2+). May function by regulating concentrations of inositol 1,4,5-trisphosphate (IP3), which in turn triggers release of Ca(2+) from internal stores. May play a role in de-etiolation.
Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query468
359478275 649 PREDICTED: uncharacterized protein LOC10 0.908 0.654 0.635 1e-157
224121764554 predicted protein [Populus trichocarpa] 0.918 0.776 0.662 1e-156
356540095 643 PREDICTED: uncharacterized protein LOC10 0.918 0.668 0.588 1e-148
356569155 650 PREDICTED: uncharacterized protein LOC10 0.918 0.661 0.583 1e-146
357462747 620 hypothetical protein MTR_3g084020 [Medic 0.914 0.690 0.587 1e-140
334186137 686 rhodanese/Cell cycle control phosphatase 0.869 0.593 0.581 1e-137
449450369 619 PREDICTED: uncharacterized protein LOC10 0.884 0.668 0.582 1e-131
449494443 619 PREDICTED: uncharacterized LOC101220363 0.884 0.668 0.582 1e-131
297817278 690 predicted protein [Arabidopsis lyrata su 0.809 0.549 0.557 1e-125
7019672 663 putative protein [Arabidopsis thaliana] 0.891 0.628 0.480 1e-119
>gi|359478275|ref|XP_002274820.2| PREDICTED: uncharacterized protein LOC100249037 [Vitis vinifera] gi|296084312|emb|CBI24700.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 270/425 (63%), Positives = 339/425 (79%)

Query: 10  KYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSLDMDNS 69
           K+++ S +   EE LVD+ D++TENA+ L      +T    ++ P NP +  DS  MDN 
Sbjct: 102 KFVDSSGLSGTEEKLVDYMDQLTENANILSGAPNLETISTTDIIPNNPNSVSDSFGMDNG 161

Query: 70  SISNIKSSFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSIKKSTSEAVDNVVSRV 129
           S+S++K++  D  +G+NES  SS+ KG++AVK+SLDTITSS+TS   S ++AVD  VS+V
Sbjct: 162 SLSSLKTNAGDLFSGINESIGSSVDKGQSAVKTSLDTITSSITSAINSATDAVDTAVSKV 221

Query: 130 FSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYG 189
           FSS+DQ G  A  ++ +FS DLKEA+SK    A+DVLR+ IV +E+S+ NGASF  Y YG
Sbjct: 222 FSSVDQAGELANDRVVSFSNDLKEATSKVGATAIDVLRHGIVLVEDSLANGASFAAYSYG 281

Query: 190 TTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQVSVAIEGLERSLGFDPNDPIVPFVVF 249
           + KE LP EIR+ +NL E++ +++ RP G+ALQQ  VA+EGLER+LG DP+DPIVPFV+F
Sbjct: 282 SAKELLPTEIRNVVNLSEEKVLEILRPAGAALQQFYVAVEGLERNLGLDPSDPIVPFVLF 341

Query: 250 LGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRG 309
           LGTSATLW+FYW  TYGGYSGD+SP+ TLELL+GKEN VL+DVR EDLRERDGIPDLRR 
Sbjct: 342 LGTSATLWVFYWRLTYGGYSGDISPQLTLELLKGKENVVLVDVRPEDLRERDGIPDLRRA 401

Query: 310 ARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKG 369
           ARFRYASV LPE   SV+KLL+ GR+LDD+L AAVIRNLKIVQDRSKVIV+DADG+RSKG
Sbjct: 402 ARFRYASVTLPEFNSSVRKLLKSGRDLDDSLIAAVIRNLKIVQDRSKVIVLDADGSRSKG 461

Query: 370 IARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQF 429
           IARSLRKLGV R +LVQGGFQSWVK+G R+KELK ET LTILNE+AEAI+EDIN +PV+ 
Sbjct: 462 IARSLRKLGVKRPYLVQGGFQSWVKQGFRVKELKPETTLTILNEEAEAIIEDINPTPVKL 521

Query: 430 LGFGV 434
           LG+GV
Sbjct: 522 LGYGV 526

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224121764|ref|XP_002330647.1| predicted protein [Populus trichocarpa] gi|222872251|gb|EEF09382.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356540095|ref|XP_003538526.1| PREDICTED: uncharacterized protein LOC100786142 [Glycine max] Back     alignment and taxonomy information
>gi|356569155|ref|XP_003552771.1| PREDICTED: uncharacterized protein LOC100786123 [Glycine max] Back     alignment and taxonomy information
>gi|357462747|ref|XP_003601655.1| hypothetical protein MTR_3g084020 [Medicago truncatula] gi|355490703|gb|AES71906.1| hypothetical protein MTR_3g084020 [Medicago truncatula] Back     alignment and taxonomy information
>gi|334186137|ref|NP_191537.4| rhodanese/Cell cycle control phosphatase-like protein [Arabidopsis thaliana] gi|332646447|gb|AEE79968.1| rhodanese/Cell cycle control phosphatase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449450369|ref|XP_004142935.1| PREDICTED: uncharacterized protein LOC101220363 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449494443|ref|XP_004159547.1| PREDICTED: uncharacterized LOC101220363 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297817278|ref|XP_002876522.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297322360|gb|EFH52781.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|7019672|emb|CAB75797.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query468
TAIR|locus:2178287387 CaS "calcium sensing receptor" 0.286 0.346 0.326 6e-14
TAIR|locus:2178287 CaS "calcium sensing receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 200 (75.5 bits), Expect = 6.0e-14, Sum P(2) = 6.0e-14
 Identities = 45/138 (32%), Positives = 79/138 (57%)

Query:   263 WTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEV 322
             + + GY GDL+P  TL+LL  K N +++D+R E  +E+ GIP L   A+ R  S+ L E+
Sbjct:   212 FNFRGYKGDLTPAQTLDLLCTK-NYLMVDIRSEKDKEKAGIPRLPSNAKNRVISIPLEEL 270

Query:   323 GGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRA 382
                VK ++R  + ++  + A  I  LK +   S +I++D+    +K +A++L+ LG    
Sbjct:   271 PNKVKGIVRNSKRVEAEIAALKISYLKKINKGSNIIILDSYTDSAKIVAKTLKVLGYKNC 330

Query:   383 FLVQGGF---QSWVKEGL 397
             ++V  GF   + W++  L
Sbjct:   331 YIVTDGFSGGRGWLQSRL 348
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0071277 "cellular response to calcium ion" evidence=IMP
GO:0090333 "regulation of stomatal closure" evidence=IMP
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0009704 "de-etiolation" evidence=IMP
GO:0000023 "maltose metabolic process" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0006636 "unsaturated fatty acid biosynthetic process" evidence=RCA
GO:0009416 "response to light stimulus" evidence=RCA
GO:0009637 "response to blue light" evidence=RCA
GO:0009657 "plastid organization" evidence=RCA
GO:0009773 "photosynthetic electron transport in photosystem I" evidence=RCA
GO:0010114 "response to red light" evidence=RCA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0010218 "response to far red light" evidence=RCA
GO:0015979 "photosynthesis" evidence=RCA
GO:0015994 "chlorophyll metabolic process" evidence=RCA
GO:0019216 "regulation of lipid metabolic process" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019344 "cysteine biosynthetic process" evidence=RCA
GO:0019684 "photosynthesis, light reaction" evidence=RCA
GO:0031408 "oxylipin biosynthetic process" evidence=RCA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_1420041
hypothetical protein (555 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query468
smart00450100 smart00450, RHOD, Rhodanese Homology Domain 2e-10
COG0607110 COG0607, PspE, Rhodanese-related sulfurtransferase 2e-08
cd0015889 cd00158, RHOD, Rhodanese Homology Domain (RHOD); a 5e-06
PRK08762 376 PRK08762, PRK08762, molybdopterin biosynthesis pro 2e-05
cd0152799 cd01527, RHOD_YgaP, Member of the Rhodanese Homolo 0.001
pfam0373574 pfam03735, ENT, ENT domain 0.004
pfam00581106 pfam00581, Rhodanese, Rhodanese-like domain 0.004
>gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain Back     alignment and domain information 
 Score = 57.5 bits (139), Expect = 2e-10
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 16/115 (13%)

Query: 283 GKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTA 342
             E  VL+DVR  +  E   IP           +V +P     + +LL    ELD     
Sbjct: 1   NDEKVVLLDVRSPEEYEGGHIPG----------AVNIP-----LSELLDRRGELDILEFE 45

Query: 343 AVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGL 397
            +++ L + +D+  V+V    G RS   A  LR+LG    +L+ GG++ W   G 
Sbjct: 46  ELLKRLGLDKDK-PVVVYCRSGNRSAKAAWLLRELGFKNVYLLDGGYKEWSAAGP 99

An alpha beta fold found duplicated in the Rhodanese protein. The the Cysteine containing enzymatically active version of the domain is also found in the CDC25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and stress proteins such as Senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions with a loss of the cysteine are also seen in Dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases. These are likely to play a role in protein interactions. Length = 100
>gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|238785 cd01527, RHOD_YgaP, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|146396 pfam03735, ENT, ENT domain Back     alignment and domain information
>gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 468
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 99.82
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 99.81
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 99.8
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 99.8
PLN02160136 thiosulfate sulfurtransferase 99.79
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 99.78
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 99.78
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 99.78
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 99.78
PRK07411390 hypothetical protein; Validated 99.77
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 99.77
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 99.77
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 99.77
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.76
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.76
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 99.76
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 99.76
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 99.76
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 99.75
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 99.74
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 99.74
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 99.73
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 99.73
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.73
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 99.73
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 99.72
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 99.72
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 99.72
KOG1530136 consensus Rhodanese-related sulfurtransferase [Ino 99.72
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 99.71
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.71
PLN02723 320 3-mercaptopyruvate sulfurtransferase 99.71
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 99.7
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.69
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 99.69
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 99.69
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 99.69
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.68
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 99.68
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 99.68
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 99.67
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 99.66
PRK05600370 thiamine biosynthesis protein ThiF; Validated 99.64
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 99.63
PRK01415247 hypothetical protein; Validated 99.63
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 99.63
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.62
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 99.6
PRK05320257 rhodanese superfamily protein; Provisional 99.59
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 99.58
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 99.57
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 99.55
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 99.48
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 99.42
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 99.12
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 99.07
COG1054308 Predicted sulfurtransferase [General function pred 98.97
KOG3772325 consensus M-phase inducer phosphatase [Cell cycle 98.54
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 98.37
COG5105427 MIH1 Mitotic inducer, protein phosphatase [Cell di 97.42
PF0523784 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 T 95.64
COG2603 334 Predicted ATPase [General function prediction only 94.73
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 94.6
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 94.18
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 92.2
KOG1093725 consensus Predicted protein kinase (contains TBC a 88.94
KOG1717 343 consensus Dual specificity phosphatase [Defense me 88.49
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 86.47
PRK08223287 hypothetical protein; Validated 84.02
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 83.43
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information 
Probab=99.82  E-value=3.9e-20  Score=158.59  Aligned_cols=99  Identities=25%  Similarity=0.200  Sum_probs=84.1

Q ss_pred             cccCHHHHHHHHhCCCCcEEEEcCChhhHhhcCCCCCcccccccccccCcccccchhhhhhcCchhhHHHHHHHHHhhhc
Q 012189          270 GDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLK  349 (468)
Q Consensus       270 ~~ISp~el~elL~~~~~avLIDVRs~~Ey~~gHIPGA~~a~~~~~~nIPl~el~~~l~~ll~~~~~L~~~l~alGI~~Lk  349 (468)
                      ..|+++++.++++++++.+|||||++.||..+|||||+        |+|+.++......              ++.    
T Consensus        10 ~~i~~~~l~~~~~~~~~~~liDvR~~~e~~~ghIpgai--------nip~~~l~~~~~~--------------l~~----   63 (109)
T cd01533          10 PSVSADELAALQARGAPLVVLDGRRFDEYRKMTIPGSV--------SCPGAELVLRVGE--------------LAP----   63 (109)
T ss_pred             CcCCHHHHHHHHhcCCCcEEEeCCCHHHHhcCcCCCce--------eCCHHHHHHHHHh--------------cCC----
Confidence            47999999999865556899999999999999999999        9998665443222              111    


Q ss_pred             ccCCCceEEEEeCCCchHHHHHHHHHHccCCC-EEEecchHHHHHHcC
Q 012189          350 IVQDRSKVIVMDADGTRSKGIARSLRKLGVMR-AFLVQGGFQSWVKEG  396 (468)
Q Consensus       350 ~l~kd~~IVVyC~sG~RS~~AA~~L~~~Gf~n-V~vLdGG~~aW~~aG  396 (468)
                        +++++||+||++|.||..+++.|+..||++ |++|+||+.+|..+|
T Consensus        64 --~~~~~ivv~C~~G~rs~~a~~~L~~~G~~~~v~~l~gG~~~W~~~g  109 (109)
T cd01533          64 --DPRTPIVVNCAGRTRSIIGAQSLINAGLPNPVAALRNGTQGWTLAG  109 (109)
T ss_pred             --CCCCeEEEECCCCchHHHHHHHHHHCCCCcceeEecCCHHHHHhcC
Confidence              567899999999999999999999999987 999999999999876

This CD includes putative rhodanese-related sulfurtransferases which contain 4 copies of the Rhodanese Homology Domain. This CD aligns the 2nd repeat which does contain the putative catalytic Cys residue.
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF05237 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 This putative domain is found in the MoeZ protein and the MoeB protein Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query468
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 1e-16
1vee_A134 Proline-rich protein family; hypothetical protein, 5e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 4e-09
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 6e-08
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 2e-07
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 3e-07
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 1e-05
1tq1_A129 AT5G66040, senescence-associated family protein; C 1e-05
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 2e-05
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 2e-05
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 7e-05
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 9e-05
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 2e-04
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 Back     alignment and structure
 Score = 75.9 bits (186), Expect = 1e-16
 Identities = 35/131 (26%), Positives = 50/131 (38%), Gaps = 11/131 (8%)

Query: 267 GYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSV 326
            Y+GD++P    E+L     AVL+DVR E      G+PDL            L      V
Sbjct: 2   SYAGDITPLQAWEMLSDNPRAVLVDVRCEAEWRFVGVPDLSS----------LGREVVYV 51

Query: 327 KKLLRGGRELDDTLTAAVIRNLKIVQDRSK-VIVMDADGTRSKGIARSLRKLGVMRAFLV 385
           +     G   D+ L     R         + VI +   G RS G A    + G+  A+ V
Sbjct: 52  EWATSDGTHNDNFLAELRDRIPADADQHERPVIFLCRSGNRSIGAAEVATEAGITPAYNV 111

Query: 386 QGGFQSWVKEG 396
             GF+  +   
Sbjct: 112 LDGFEGHLDAE 122
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query468
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.9
3foj_A100 Uncharacterized protein; protein SSP1007, structur 99.89
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.89
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 99.86
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 99.86
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 99.86
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 99.85
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 99.85
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 99.85
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 99.84
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 99.83
1tq1_A129 AT5G66040, senescence-associated family protein; C 99.83
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 99.82
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.82
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.81
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 99.81
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 99.81
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 99.81
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.8
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 99.8
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.8
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.79
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.79
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.79
1vee_A134 Proline-rich protein family; hypothetical protein, 99.78
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.78
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 99.78
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.78
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.77
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.77
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 99.76
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.76
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.75
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.75
2jtq_A85 Phage shock protein E; solution structure rhodanes 99.74
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 99.73
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.73
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.73
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 99.72
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 99.72
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 99.71
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.71
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 99.71
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 99.71
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.7
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 99.69
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 99.67
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 99.67
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.66
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.66
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 99.64
3op3_A216 M-phase inducer phosphatase 3; structural genomics 99.64
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.61
1okg_A373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.6
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 99.59
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.58
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.57
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.56
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 99.54
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 99.54
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.49
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.46
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.37
3r2u_A466 Metallo-beta-lactamase family protein; structural 98.95
2f46_A156 Hypothetical protein; structural genomics, joint c 96.35
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 82.38
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 81.6
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
Probab=99.90  E-value=4.6e-24  Score=181.90  Aligned_cols=101  Identities=22%  Similarity=0.377  Sum_probs=90.3

Q ss_pred             cccCHHHHHHHHhCCCCcEEEEcCChhhHhhcCCCCCcccccccccccCcccccchhhhhhcCchhhHHHHHHHHHhhhc
Q 012189          270 GDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLK  349 (468)
Q Consensus       270 ~~ISp~el~elL~~~~~avLIDVRs~~Ey~~gHIPGA~~a~~~~~~nIPl~el~~~l~~ll~~~~~L~~~l~alGI~~Lk  349 (468)
                      ++||++|+.+++.++++++|||||++.||+.||||||+        |+|+.++...+.+                     
T Consensus         2 k~Is~~el~~~l~~~~~~~liDvR~~~e~~~ghIpgA~--------~ip~~~l~~~~~~---------------------   52 (103)
T 3iwh_A            2 KSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNAK--------LIPMDTIPDNLNS---------------------   52 (103)
T ss_dssp             CEECHHHHHHGGGSSSCCEEEECSCHHHHTTCBCTTCE--------ECCGGGGGGCGGG---------------------
T ss_pred             CCcCHHHHHHHHhCCCCeEEEECCChhHHhcCccCCcc--------cCcccchhhhhhh---------------------
Confidence            46999999999877778999999999999999999999        9999887654432                     


Q ss_pred             ccCCCceEEEEeCCCchHHHHHHHHHHccCCCEEEecchHHHHHHcCCCccc
Q 012189          350 IVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKE  401 (468)
Q Consensus       350 ~l~kd~~IVVyC~sG~RS~~AA~~L~~~Gf~nV~vLdGG~~aW~~aGLPv~~  401 (468)
                       ++++++||+||++|.||..+++.|++.||+ +++|.||+.+|+++|+|++.
T Consensus        53 -l~~~~~ivv~C~~G~rS~~aa~~L~~~G~~-~~~l~GG~~~W~~~g~pves  102 (103)
T 3iwh_A           53 -FNKNEIYYIVCAGGVRSAKVVEYLEANGID-AVNVEGGMHAWGDEGLEIKS  102 (103)
T ss_dssp             -CCTTSEEEEECSSSSHHHHHHHHHHTTTCE-EEEETTHHHHHCSSSCBCCC
T ss_pred             -hcCCCeEEEECCCCHHHHHHHHHHHHcCCC-EEEecChHHHHHHCCCccee
Confidence             378999999999999999999999999995 55799999999999999874
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 468
d1tq1a_119 c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc 2e-06
d1gmxa_108 c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia 2e-05
d2gwfa1135 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h 9e-05
d1qxna_137 c.46.1.3 (A:) Polysulfide-sulfur transferase (sulf 3e-04
d1yt8a1136 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase 4e-04
d1hzma_154 c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat 0.003
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 44.5 bits (104), Expect = 2e-06
 Identities = 24/129 (18%), Positives = 35/129 (27%), Gaps = 20/129 (15%)

Query: 272 LSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLR 331
           +S     +LL        +DVR  +   +        GA                     
Sbjct: 10  VSVTVAHDLL--LAGHRYLDVRTPEEFSQGHAC----GAINVPYMNR------------- 50

Query: 332 GGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQS 391
            G       T  + +          +IV    G RS      L   G      + GG+ +
Sbjct: 51  -GASGMSKNTDFLEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSA 109

Query: 392 WVKEGLRIK 400
           W K GL  K
Sbjct: 110 WAKNGLPTK 118
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Length = 137 Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 136 Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query468
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.87
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 99.85
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 99.85
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.84
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 99.84
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.84
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.84
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 99.84
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.83
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.83
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.82
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.78
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.77
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.77
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 99.76
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.75
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 99.72
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.68
d1c25a_161 CDC25a {Human (Homo sapiens) [TaxId: 9606]} 99.59
d2gwfa1135 Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum 99.55
d1ymka1174 CDC25b {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1hzma_154 Erk2 binding domain of Mapk phosphatase mkp-3 {Hum 99.4
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 82.58
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Multidomain sulfurtransferase (rhodanese)
domain: Thiosulfate sulfurtransferase PA2603
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=99.87  E-value=1.6e-22  Score=178.12  Aligned_cols=106  Identities=27%  Similarity=0.283  Sum_probs=93.8

Q ss_pred             cccCHHHHHHHHhCCCCcEEEEcCChhhHhhcCCCCCcccccccccccCcccccchhhhhhcCchhhHHHHHHHHHhhhc
Q 012189          270 GDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLK  349 (468)
Q Consensus       270 ~~ISp~el~elL~~~~~avLIDVRs~~Ey~~gHIPGA~~a~~~~~~nIPl~el~~~l~~ll~~~~~L~~~l~alGI~~Lk  349 (468)
                      ..|+++++.++++++++++|||||++.||+.||||||+        |+|...+...+.++.                   
T Consensus        24 ~~Is~~el~~~l~~~~~~~liDvR~~~e~~~ghIpGAi--------~ip~~~l~~~~~~l~-------------------   76 (136)
T d1yt8a1          24 PSLAAEEVQALLDARAEAVILDARRFDEYQTMSIPGGI--------SVPGAELVLRVAELA-------------------   76 (136)
T ss_dssp             CEECHHHHHHHHHTTCSEEEEECSCHHHHHHSBCTTCE--------ECCGGGHHHHHHHHC-------------------
T ss_pred             CccCHHHHHHHHhcCCCcEEEEcCChhhccceecCCch--------hhhhhHHHHHhhccc-------------------
Confidence            47999999999977778999999999999999999999        999877765544321                   


Q ss_pred             ccCCCceEEEEeCCCchHHHHHHHHHHccCCC-EEEecchHHHHHHcCCCccccc
Q 012189          350 IVQDRSKVIVMDADGTRSKGIARSLRKLGVMR-AFLVQGGFQSWVKEGLRIKELK  403 (468)
Q Consensus       350 ~l~kd~~IVVyC~sG~RS~~AA~~L~~~Gf~n-V~vLdGG~~aW~~aGLPv~~~~  403 (468)
                       .+++++||+||++|.||..++.+|+++||++ |++|+||+.+|+.+|+|++++.
T Consensus        77 -~~~~~~iV~~C~~g~rs~~aa~~L~~~G~~~~V~~L~GG~~~W~~~G~pve~g~  130 (136)
T d1yt8a1          77 -PDPRTRVIVNCAGRTRSIIGTQSLLNAGIPNPVAALRNGTIGWTLAGQQLEHGQ  130 (136)
T ss_dssp             -CSTTSEEEEECSSSHHHHHHHHHHHHTTCSSCEEEETTHHHHHHHTTCCCBCSC
T ss_pred             -ccccceEEEEcCCCCchHHHHHHHHHcCCCceEEEeCCcHHHHHHCCCCceeCC
Confidence             1577899999999999999999999999986 9999999999999999999874
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure