BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 012196
(468 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1FBL|A Chain A, Structure Of Full-Length Porcine Synovial Collagenase
(Mmp1) Reveals A C-Terminal Domain Containing A
Calcium-Linked, Four-Bladed Beta- Propeller
Length = 370
Score = 29.6 bits (65), Expect = 3.7, Method: Compositional matrix adjust.
Identities = 16/52 (30%), Positives = 24/52 (46%)
Query: 11 LKNDHQETKPMMGINKSFKKRGQLGNGIDGDHHESDNNSATKLQKFYKSYRT 62
++ DH++ P G + Q G GI GD H ++ TK + Y YR
Sbjct: 65 VRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTKNFRDYNLYRV 116
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.315 0.132 0.396
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,520,413
Number of Sequences: 62578
Number of extensions: 612042
Number of successful extensions: 1263
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1260
Number of HSP's gapped (non-prelim): 7
length of query: 468
length of database: 14,973,337
effective HSP length: 102
effective length of query: 366
effective length of database: 8,590,381
effective search space: 3144079446
effective search space used: 3144079446
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)