Citrus Sinensis ID: 012201


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------47
MDGASNRSSSGVDMFLPNYKLGKTLGIGSFGKVKIAEHALTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETPSDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKWNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLIVDPMKRITIPEIRQHPWFQAHLPRYLAVPPPDTMQQAKKIDEEILKEVVKMGFDQNQLVESLRNRLQNEATVAYYLLLDNRFRVSSGYLGAEFQETMSRAHPREIMTEVLKALQELNVGWKKIGHYNMKCRWIPGISGHHEGMVNNPLHSNHYFGDESAIIENDGVVKSPNVVKFEVQLYKTRDEKYLLDLQRVQGPQFLFLDLCAAFLAQLRVL
ccccccccccccccccccEEEEEEEEccccEEEEEEEEEccccEEEEEEEEccccccHHHHHHHHHHHHHHHHccccccccEEEEEEcccEEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEECcccccccccccccECccccccccccccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccccHHHHHccccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccEEEEEEccccccHHHHHHHHHHHHHHccc
************DMFLPNYKLGKTLGIGSFGKVKIAEHALTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETPSDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKWNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLIVDPMKRITIPEIRQHPWFQAHLPRYLAVP********KKIDEEILKEVVKMGFDQNQLVESLRNRLQNEATVAYYLLLDNRFR****************AHPREIMTEVLKALQELNVGWKKIGHYNMKCRWIPGISGHHEGMVNNPLHSNHYFGDESAIIENDGVVKSPNVVKFEVQLYKTRDEKYLLDLQRVQGPQFLFLDLCAAFLAQLRVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGASNRSSSGVDMFLPNYKLGKTLGIGSFGKVKIAEHALTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETPSDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKWNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLIVDPMKRITIPEIRQHPWFQAHLPRYLAVPPPDTMQQAKKIDEEILKEVVKMGFDQNQLVESLRNRLQNEATVAYYLLLDNRFRVSSGYLGAEFQETMSRAHPREIMTEVLKALQELNVGWKKIGHYNMKCRWIPGISGHHEGMVNNPLHSNHYFGDESAIIENDGVVKSPNVVKFEVQLYKTRDEKYLLDLQRVQGPQFLFLDLCAAFLAQLRVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
SNF1-related protein kinase catalytic subunit alpha KIN10 Catalytic subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants. The SnRK complex may also be involved in the regulation of fatty acid synthesis by phosphorylation of acetyl-CoA carboxylase and in assimilation of nitrogen by phosphorylating nitrate reductase. In vitro, KIN10 exhibits kinase activity on sucrose phosphate synthase and the kinase activity is inhibited by PRL1. May be a subunit of a SCF ubiquitin ligase complex and thus be involved in proteasomal ubiquitination.confidentQ38997
Carbon catabolite-derepressing protein kinase Essential for release from glucose repression.probableQ02723
SNF1-related protein kinase catalytic subunit alpha KIN11 Catalytic subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants. The SnRK complex may also be involved in the regulation of fatty acid synthesis by phosphorylation of acetyl-CoA carboxylase and in assimilation of nitrogen by phosphorylating nitrate reductase. In vitro, KIN11 exhibits kinase activity on sucrose phosphate synthase and the kinase activity is inhibited by PRL1. May be a subunit of a SCF ubiquitin ligase complex and thus be involved in proteasomal ubiquitination. Involved in innate antiviral defenses.probableP92958

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H6D, chain A
Confidence level:very confident
Coverage over the Query: 13-169,183-279
View the alignment between query and template
View the model in PyMOL
Template: 2Y94, chain A
Confidence level:very confident
Coverage over the Query: 10-300,330-390,423-450
View the alignment between query and template
View the model in PyMOL
Template: 3T4N, chain A
Confidence level:confident
Coverage over the Query: 350-387,422-467
View the alignment between query and template
View the model in PyMOL