Citrus Sinensis ID: 012205


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------47
MDKLCFPLLLLLLLVQLCMQLAASYSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPKNEVCLNDIQAFSKLTSEIEGAHILEPRCPFSSPKPRESSRKRRSLNVNEQSQEFLVPEPPLPTIGCRTYGYLLSYYWNNDYNVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNRMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL
cHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEcccccEEEEEEEEECccccccccEEEEEccccccccHHHcccccccEEEEEccccccccCEEEccccccccccEEEECcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHcccccccccccEEEEEEEcccccccccccccHHHHcccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccHHcccccccccccccccccccccccccccccHHHHHHHHcccHHHHHHHccccccccccccccccccccccccccHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHccccccccccccccccCEEEEEEEEcccEEEEEEcccccccccccHHHHHHHHHHHHccccc
**KLCFPLLLLLLLVQLCMQLAASYSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPKNEVCLNDIQAFSKLTSEIEGAHILEPRCPFS*****************EQSQEFLVPEPPLPTIGCRTYGYLLSYYWNNDYNVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNRMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL
xxxxxHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKLCFPLLLLLLLVQLCMQLAASYSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPKNEVCLNDIQAFSKLTSEIEGAHILEPRCPFSSPKPRESSRKRRSLNVNEQSQEFLVPEPPLPTIGCRTYGYLLSYYWNNDYNVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNRMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine carboxypeptidase-like 19 Involved in plants secondary metabolism. Functions as acyltransferase to form the sinapate ester sinapoylcholine also known as sinapine. May rather catalyze a transesterification reaction rather than a hydrolysis. May also have carboxypeptidase activity.probableQ8VZU3
Lysosomal protective protein Protective protein appears to be essential for both the activity of beta-galactosidase and neuraminidase, it associates with these enzymes and exerts a protective function necessary for their stability and activity. This protein is also a carboxypeptidase and can deamidate tachykinins.probableQ3MI05
Lysosomal protective protein Protective protein appears to be essential for both the activity of beta-galactosidase and neuraminidase, it associates with these enzymes and exerts a protective function necessary for their stability and activity. This protein is also a carboxypeptidase and can deamidate tachykinins.probableP10619

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.16.-Serine-type carboxypeptidases.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IVY, chain A
Confidence level:very confident
Coverage over the Query: 22-468
View the alignment between query and template
View the model in PyMOL