Citrus Sinensis ID: 012230


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------47
MASTVDSAAEQLSKLGIDGAFADSAPNLKKNLHLLSSEQVELAKMLMEMGQSHLFEKWAAPGVDDNEKRAFFDQVAKLNSSYPGGLKSYIKTARELLADSKAGKNPFDGFTPSVPTGEVLKFGDDTFINYEQAGVKEAKNAAFVLVAGGLGERLGYNGIKVALPAETTTGTCFLQNYIECILALQESSCRLAEGKCQEIPFAIMTSDDTHSRTQELLESNSYFGMKPTQVKLLKQEKVACLDDNDARLAMDPKNKYRIQTKPHGHGDVHALLYSSGLLKEWHDAGLKWVLFFQDTNGLLFKAIPASLGVSATKQYHVNSLAVPRKAKEAIGGITRLTHADGRSMVINVEYNQLDPLLRATGFPDGDVNCETGYSPFPGNINQLILELGPYMEELKKTGGAIKEFVNPKYKDASKTSFKSSTRLECMMQDYPKTLPPSAKVGFTVMDTWLAYAPVKNNPEDAAKVNSLR
ccccHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHccccHHccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHcHHHHccEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHccccccccccEEEEEEEccEEEEcccccccccccccccccccccccccHHHHHHHHccHHHHHHHccccEEEEEEcccccccccccHHHHHHHccccccccccccccccccEEEEEEEECccccEEEEEEccccccHHHHHccccccccccccccccccccccEEEccHHHHHHHHHHcccccccccccccccccccccccccEEccccccccccccccccEEEEEEcccccccccccccccccHccccc
***************************************VELAKMLMEMGQSHLFEKWAAPGVDDNEKRAFFDQVAKLNSSYPGGLKSYIKTARELLA********FDGFTPSVPTGEVLKFGDDTFINYEQAGVKEAKNAAFVLVAGGLGERLGYNGIKVALPAETTTGTCFLQNYIECILALQESSCRLAEGKCQEIPFAIMTSDDTHSRTQELLESNSYFGMKPTQVKLLKQEKVACLDDNDARLAMDPKNKYRIQTKPHGHGDVHALLYSSGLLKEWHDAGLKWVLFFQDTNGLLFKAIPASLGVSATKQYHVNSLAVPRKAKEAIGGITRLTHADGRSMVINVEYNQLDPLLRATGFPDGDVNCETGYSPFPGNINQLILELGPYMEELKKTGGAIKEFVNPKYKDASKTSFKSSTRLECMMQDYPKTLPPSAKVGFTVMDTWLAYAPVKNNPE*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASTVDSAAEQLSKLGIDGAFADSAPNLKKNLHLLSSEQVELAKMLMEMGQSHLFEKWAAPGVDDNEKRAFFDQVAKLNSSYPGGLKSYIKTARELLADSKAGKNPFDGFTPSVPTGEVLKFGDDTFINYEQAGVKEAKNAAFVLVAGGLGERLGYNGIKVALPAETTTGTCFLQNYIECILALQESSCRLAEGKCQEIPFAIMTSDDTHSRTQELLESNSYFGMKPTQVKLLKQEKVACLDDNDARLAMDPKNKYRIQTKPHGHGDVHALLYSSGLLKEWHDAGLKWVLFFQDTNGLLFKAIPASLGVSATKQYHVNSLAVPRKAKEAIGGITRLTHADGRSMVINVEYNQLDPLLRATGFPDGDVNCETGYSPFPGNINQLILELGPYMEELKKTGGAIKEFVNPKYKDASKTSFKSSTRLECMMQDYPKTLPPSAKVGFTVMDTWLAYAPVKNNPEDAAKVNSLR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UDP-sugar pyrophosphorylase 1 May function as the terminal enzyme of the myo-inositol oxidation (MIO) pathway. May also play a role in the salvage pathway for synthesis of nucleotide sugars.probableQ09WE7
UDP-sugar pyrophosphorylase May function as the terminal enzyme of the myo-inositol oxidation (MIO) pathway. May also play a role in the salvage pathway for synthesis of nucleotide sugars.probableQ5Z8Y4
UDP-sugar pyrophosphorylase Required for the synthesis of the intine, the pectocellulosic inner wall of developing pollen. May function as the terminal enzyme of the myo-inositol oxidation (MIO) pathway. May also play a role in the salvage pathway for synthesis of nucleotide sugars.probableQ9C5I1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.7.-Nucleotidyltransferases.probable
2.7.7.64UTP-monosaccharide-1-phosphate uridylyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OGZ, chain A
Confidence level:very confident
Coverage over the Query: 36-360,372-460
View the alignment between query and template
View the model in PyMOL
Template: 1JV1, chain A
Confidence level:very confident
Coverage over the Query: 38-97,109-466
View the alignment between query and template
View the model in PyMOL