BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 012231
         (468 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1P9R|A Chain A, Crystal Structure Of Vibrio Cholerae Putative Ntpase Epse
 pdb|1P9W|A Chain A, Crystal Structure Of Vibrio Cholerae Putative Ntpase Epse
          Length = 418

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 166 LLSALNQRLKLVLQRKTKEAFEATKRLKELLESRK---ALTHRTAGSKTGNHSQFQS 219
           LL  L QRL   L    KE +EA K  ++L +S+K    + +R  G    NH  ++ 
Sbjct: 294 LLGVLAQRLVRTLCPDCKEPYEADKEQRKLFDSKKKEPLILYRATGCPKCNHKGYRG 350


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.311    0.126    0.335 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,426,837
Number of Sequences: 62578
Number of extensions: 285736
Number of successful extensions: 676
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 668
Number of HSP's gapped (non-prelim): 14
length of query: 468
length of database: 14,973,337
effective HSP length: 102
effective length of query: 366
effective length of database: 8,590,381
effective search space: 3144079446
effective search space used: 3144079446
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 53 (25.0 bits)