BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 012231
(468 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1P9R|A Chain A, Crystal Structure Of Vibrio Cholerae Putative Ntpase Epse
pdb|1P9W|A Chain A, Crystal Structure Of Vibrio Cholerae Putative Ntpase Epse
Length = 418
Score = 30.4 bits (67), Expect = 2.3, Method: Compositional matrix adjust.
Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%)
Query: 166 LLSALNQRLKLVLQRKTKEAFEATKRLKELLESRK---ALTHRTAGSKTGNHSQFQS 219
LL L QRL L KE +EA K ++L +S+K + +R G NH ++
Sbjct: 294 LLGVLAQRLVRTLCPDCKEPYEADKEQRKLFDSKKKEPLILYRATGCPKCNHKGYRG 350
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.311 0.126 0.335
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,426,837
Number of Sequences: 62578
Number of extensions: 285736
Number of successful extensions: 676
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 668
Number of HSP's gapped (non-prelim): 14
length of query: 468
length of database: 14,973,337
effective HSP length: 102
effective length of query: 366
effective length of database: 8,590,381
effective search space: 3144079446
effective search space used: 3144079446
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 53 (25.0 bits)