BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 012251
         (467 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3ILN|A Chain A, X-Ray Structure Of The Laminarinase From Rhodothermus
           Marinus
 pdb|3ILN|B Chain B, X-Ray Structure Of The Laminarinase From Rhodothermus
           Marinus
          Length = 251

 Score = 28.5 bits (62), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 2/64 (3%)

Query: 141 PDKNS-DNGKHVLYTHKIINFKYNKDQIIHVNLTQDGPK-PLEVGRTLDMTYSVKWTPTN 198
           PD    D  +HV +   +++   +     H+  TQ G    +   RT    Y+++WTP  
Sbjct: 119 PDNGEIDIAEHVGFNPDVVHGTVHTKAYNHLLGTQRGGSIRVPTARTDFHVYAIEWTPEE 178

Query: 199 IHWF 202
           I WF
Sbjct: 179 IRWF 182


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.140    0.453 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,799,002
Number of Sequences: 62578
Number of extensions: 513138
Number of successful extensions: 1212
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1212
Number of HSP's gapped (non-prelim): 2
length of query: 467
length of database: 14,973,337
effective HSP length: 102
effective length of query: 365
effective length of database: 8,590,381
effective search space: 3135489065
effective search space used: 3135489065
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 53 (25.0 bits)