Citrus Sinensis ID: 012279

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------

MTTMESLIGLVNRIQRACTMLGDYGGGDNAFSSLWEALPSVAVVGGQSSGKSSVLESVVGRDFLPRGSGIVTRRPLVLQLHKTEDGSQEYAEFLHLPKRRFTDFSMVRKEIQDETDRVTGKTKQISPIPIHLSIYSPNVVNLTLIDLPGLTKVAVEGQPDTIVEDIESMVRSYVEKPNSVILAISPANQDIATSDAMKLAREVDPTGERTFGVLTKLDLMDKGTNALDVLEGRSYRLQHPWVGIVNRSQADINRNIDMIVARRKEREYFATSPDYGHLAGKMGSEYLAKLLSKHLESVIRSRIPSITSLINKSIEELESEMDHLGRPIAVDAGAQLYTILELCRAFDRIFKEHLDGGRPGGDRIYGVFDNQLPAALRKLPFDRHLSLQNVKKVVSEADGYQPHLIAPEQGYRRLIEGSLSYFRGPAEASADAVHFVLKELVRKSIGETQVELYKLYLISELTGKFMY

cHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEccccccccHHHHcccccccccccccccccccEEEEEEEcccccccEEEEEcccccccccHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccccccccccccCEcccccccccHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHcccccccEEEEEcccccccccccHHHHHccccccccccEEEEEcccHHHHcccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHcHHHHHHcccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccHHHHHHcccc

**TMESLIGLVNRIQRACTMLGDYGGGDNAFSSLWEALPSVAVVGGQSSGKSSVLESVVGRDFLPRGSGIVTRRPLVLQLHKTEDGSQEYAEFLHLPKRRFTDFSMVRKEIQD**********QISPIPIHLSIYSPNVVNLTLIDLPGLTKVAVEGQPDTIVEDIESMVRSYVEKPNSVILAISPANQDIATSDAMKLAREVDPTGERTFGVLTKLDLMDKGTNALDVLEGRSYRLQHPWVGIVNRSQADINRNIDMIVARRKEREYFATSPDYGHLAGKMGSEYLAKLLSKHLESVIRSRIPSITSLINKSIEELESEMDHLGRPIAVDAGAQLYTILELCRAFDRIFKEHLDGGRPGGDRIYGVFDNQLPAALRKLPFDRHLSLQNVKKVVSEADGYQPHLIAPEQGYRRLIEGSLSYFRGPAEASADAVHFVLKELVRKSIGETQVELYKLYLISELTGKFMY

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Dynamin-related protein 1E	Microtubule-associated force-producing protein that is targeted to the tubulo-vesicular network of the forming cell plate during cytokinesis. Plays also a major role in plasma membrane maintenance and cell wall integrity with an implication in vesicular trafficking, polar cell expansion, and other aspects of plant growth and development.	probable	Q9FNX5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T34, chain A
Confidence level:very confident
Coverage over the Query: 5-323
View the alignment between query and template
View the model in PyMOL

Template: 3ZVR, chain A
Confidence level:very confident
Coverage over the Query: 3-454
View the alignment between query and template
View the model in PyMOL