Citrus Sinensis ID: 012303

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460------

MEYFQSVQLSLIVLYLYHCEFSFEYLLVIELMGGIISKRESSRQPSFGSSSYSWNHHNYPQQPPYGQPSQEYAPQQYYATPSQSYSGRAPESTRKLERKYSKIDDNYHSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFQRRSLHHIGDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDEKFCNGFEEVLRRYRELVPHLRLAGPTSFAPIIEMAITIVEHSGGQYHVLVIIADGQVTRSVDTEHGQLSSQEKKTVEAIVKASEYPLSIILVGVGDGPWDMMREFDDNIPARAFDNFQFVNFTEIMSKNVDRSRKEAEFALAALMEIPSQYKAALEFNILGAQRGKAVDRVSLPPPQYGAASQNTPKTSRSSSFRPSAPSGHERVVGTAPPASSTSDNHVCPICLTDPKDMAFGCGHQTCCGCGQDLDLCPICRSFIQTRIKLY

ccccHHHHHHHHHHHHHHccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEECcccccHHHHHHHHHHHccccEEccEEEEEccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccEEECcccccccccHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccccHHHHHHHHHHHcccccccEEEEccccccccccccccccccccccccEEEEEcHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccc

***FQSVQLSLIVLYLYHCEFSFEYLLVIELMGG******************************************************************SKIDDNYHSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFQRRSLHHIGDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDEKFCNGFEEVLRRYRELVPHLRLAGPTSFAPIIEMAITIVEHSGGQYHVLVIIADGQVTR**************KTVEAIVKASEYPLSIILVGVGDGPWDMMREFDDNIPARAFDNFQFVNFTEIMSKNVDRSRKEAEFALAALMEIPSQYKAALEFNILGAQRGKAVDRVSLPPP*****************************************NHVCPICLTDPKDMAFGCGHQTCCGCGQDLDLCPICRSFIQTRIKLY

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
E3 ubiquitin-protein ligase RGLG2	E3 ubiquitin-protein ligase that mediates the formation of 'Lys-63'-linked multiubiquitin chains. Regulates apical dominance by acting on the auxin transport proteins abundance.	confident	Q9LY87

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EA5, chain A
Confidence level:confident
Coverage over the Query: 417-466
View the alignment between query and template
View the model in PyMOL

Template: 4B4T, chain W
Confidence level:probable
Coverage over the Query: 122-140,154-261,273-324
View the alignment between query and template
View the model in PyMOL

Template: 1JEY, chain A
Confidence level:probable
Coverage over the Query: 121-302
View the alignment between query and template
View the model in PyMOL