Citrus Sinensis ID: 012304


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460------
MGIFEEMGFCGNLEFFSALPGEGEAVMGHEMETAVEEDCSDEEVDVDELERRMWRDRLLLKRLKEQNKSKEGVDSAKHRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLRAWWKEKVRFDRNGPAAIAKYQADHAIPGKNEDFGTVVSTPHTLQELQDTTLGSLLSALMQHCNPPQRRFPLEKGVAPPWWPTGTEEWWPELGLPKDQGPPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALSRKLYPDSCIPASTGGSGSFIISDISDYDVEGVDNERNVEVEEIKPLEANLFNMGAMGSRDRLMMPPSLVPRIKGEVFETHSESIQKRRQSADEPHMTIDQKIYTCEFTQCPYNDYHHGFLDRTSRNNHQLNCPYRNNGSQGCVIVLSTICSVYSPEANNFSEEPDSTSV
cccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHHHcccccccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
**IFEEMGFCGNLEFFSAL**************************VDELERRMWRDRLL************************************GILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLRAWWKEKVRFDRNGPAAIAKYQADHAIPG********VSTPHTLQELQDTTLGSLLSALMQHCNPPQRRFPLEKGVAPPWWPTGTEEWWPELGL***********PHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALSRKLYPDSCIPA*************SDYDVEGVD***************************************************************TIDQKIYTCEFTQCPYNDYHHGFLDRTSRNNHQLNCPYRNN*****VI*************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGIFEEMGFCGNLEFFSALPGEGEAVMGHEMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNKSKEGVDSAKHRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLRAWWKEKVRFDRNGPAAIAKYQADHAIPGKNEDFGTVVSTPHTLQELQDTTLGSLLSALMQHCNPPQRRFPLEKGVAPPWWPTGTEEWWPELGLPKDQGPPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALSRKLYPDSCIPASTGGSGSFIISDISDYDVEGVDNERNVEVEEIKPLEANLFNMGAMGSRDRLMMPPSLVPRIKGEVFETHSESIQKRRQSADEPHMTIDQKIYTCEFTQCPYNDYHHGFLDRTSRNNHQLNCPYRNNGSQGCVIVLSTICSVYSPEANNFSEEPDSTSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein ETHYLENE INSENSITIVE 3 Probable transcription factor acting as a positive regulator in the ethylene response pathway. Is required for ethylene responsiveness in adult plant tissues. Binds a primary ethylene response element present in the ETHYLENE-RESPONSE-FACTOR1 promoter with consequence to activate the transcription of this gene.probableO24606

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WIJ, chain A
Confidence level:very confident
Coverage over the Query: 172-299
View the alignment between query and template
View the model in PyMOL