BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 012385
         (465 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2TMD|A Chain A, Correlation Of X-Ray Deduced And Experimental Amino Acid
           Sequences Of Trimethylamine Dehydrogenase
 pdb|2TMD|B Chain B, Correlation Of X-Ray Deduced And Experimental Amino Acid
           Sequences Of Trimethylamine Dehydrogenase
 pdb|1DJN|A Chain A, Structural And Biochemical Characterization Of Recombinant
           Wild Type Trimethylamine Dehydrogenase From
           Methylophilus Methylotrophus (Sp. W3a1)
 pdb|1DJN|B Chain B, Structural And Biochemical Characterization Of Recombinant
           Wild Type Trimethylamine Dehydrogenase From
           Methylophilus Methylotrophus (Sp. W3a1)
 pdb|1O94|A Chain A, Ternary Complex Between Trimethylamine Dehydrogenase And
           Electron Transferring Flavoprotein
 pdb|1O94|B Chain B, Ternary Complex Between Trimethylamine Dehydrogenase And
           Electron Transferring Flavoprotein
 pdb|1O95|A Chain A, Ternary Complex Between Trimethylamine Dehydrogenase And
           Electron Transferring Flavoprotein
 pdb|1O95|B Chain B, Ternary Complex Between Trimethylamine Dehydrogenase And
           Electron Transferring Flavoprotein
          Length = 729

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 200 DHTCGKIENGIVKDENCDGSEGVKSYEEPLLSVDESNQLSFPWMKLGVLVLV 251
           DH C +IE G ++  N  G    ++Y  P +S  ++N  S  W++   LVLV
Sbjct: 591 DHFCSRIEPGRMEIYNIWGDGSKRTYRGPGVSPRDAN-TSHRWIEFDSLVLV 641


>pdb|1DJQ|A Chain A, Structural And Biochemical Characterization Of Recombinant
           C30a Mutant Of Trimethylamine Dehydrogenase From
           Methylophilus Methylotrophus (Sp. W3a1)
 pdb|1DJQ|B Chain B, Structural And Biochemical Characterization Of Recombinant
           C30a Mutant Of Trimethylamine Dehydrogenase From
           Methylophilus Methylotrophus (Sp. W3a1)
          Length = 729

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 200 DHTCGKIENGIVKDENCDGSEGVKSYEEPLLSVDESNQLSFPWMKLGVLVLV 251
           DH C +IE G ++  N  G    ++Y  P +S  ++N  S  W++   LVLV
Sbjct: 591 DHFCSRIEPGRMEIYNIWGDGSKRTYRGPGVSPRDAN-TSHRWIEFDSLVLV 641


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.137    0.420 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,503,689
Number of Sequences: 62578
Number of extensions: 402795
Number of successful extensions: 782
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 780
Number of HSP's gapped (non-prelim): 6
length of query: 465
length of database: 14,973,337
effective HSP length: 102
effective length of query: 363
effective length of database: 8,590,381
effective search space: 3118308303
effective search space used: 3118308303
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)