BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 012385
(465 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2TMD|A Chain A, Correlation Of X-Ray Deduced And Experimental Amino Acid
Sequences Of Trimethylamine Dehydrogenase
pdb|2TMD|B Chain B, Correlation Of X-Ray Deduced And Experimental Amino Acid
Sequences Of Trimethylamine Dehydrogenase
pdb|1DJN|A Chain A, Structural And Biochemical Characterization Of Recombinant
Wild Type Trimethylamine Dehydrogenase From
Methylophilus Methylotrophus (Sp. W3a1)
pdb|1DJN|B Chain B, Structural And Biochemical Characterization Of Recombinant
Wild Type Trimethylamine Dehydrogenase From
Methylophilus Methylotrophus (Sp. W3a1)
pdb|1O94|A Chain A, Ternary Complex Between Trimethylamine Dehydrogenase And
Electron Transferring Flavoprotein
pdb|1O94|B Chain B, Ternary Complex Between Trimethylamine Dehydrogenase And
Electron Transferring Flavoprotein
pdb|1O95|A Chain A, Ternary Complex Between Trimethylamine Dehydrogenase And
Electron Transferring Flavoprotein
pdb|1O95|B Chain B, Ternary Complex Between Trimethylamine Dehydrogenase And
Electron Transferring Flavoprotein
Length = 729
Score = 30.8 bits (68), Expect = 1.9, Method: Compositional matrix adjust.
Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
Query: 200 DHTCGKIENGIVKDENCDGSEGVKSYEEPLLSVDESNQLSFPWMKLGVLVLV 251
DH C +IE G ++ N G ++Y P +S ++N S W++ LVLV
Sbjct: 591 DHFCSRIEPGRMEIYNIWGDGSKRTYRGPGVSPRDAN-TSHRWIEFDSLVLV 641
>pdb|1DJQ|A Chain A, Structural And Biochemical Characterization Of Recombinant
C30a Mutant Of Trimethylamine Dehydrogenase From
Methylophilus Methylotrophus (Sp. W3a1)
pdb|1DJQ|B Chain B, Structural And Biochemical Characterization Of Recombinant
C30a Mutant Of Trimethylamine Dehydrogenase From
Methylophilus Methylotrophus (Sp. W3a1)
Length = 729
Score = 30.8 bits (68), Expect = 1.9, Method: Compositional matrix adjust.
Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
Query: 200 DHTCGKIENGIVKDENCDGSEGVKSYEEPLLSVDESNQLSFPWMKLGVLVLV 251
DH C +IE G ++ N G ++Y P +S ++N S W++ LVLV
Sbjct: 591 DHFCSRIEPGRMEIYNIWGDGSKRTYRGPGVSPRDAN-TSHRWIEFDSLVLV 641
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.137 0.420
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,503,689
Number of Sequences: 62578
Number of extensions: 402795
Number of successful extensions: 782
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 780
Number of HSP's gapped (non-prelim): 6
length of query: 465
length of database: 14,973,337
effective HSP length: 102
effective length of query: 363
effective length of database: 8,590,381
effective search space: 3118308303
effective search space used: 3118308303
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)