Citrus Sinensis ID: 012440

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460---

MAQQYTVQVVDESHIAPPPGSVPPTVIPLTFLDVSWLFCCPIERILFYELPFPTRHLMQNIIPHLKHSLSLTLHHFFPLAGNLACNSKPFIQFNEGDSVRVTVTESDADFGHLVANHLRDNRAFKPLVPKLPFPFPSVSSDNKTPVMAIQVTVFPNSGISIGVTFIHVAADGSSFNHFMKSWASIHKSVTVSETLPPLSLPCHDRNVIKDPNGLLLSIYLKDWRSVHNSDATAPAIDENVQVDNVRVTLVPSRDQIDKLKQRVSAQIRSDDESPSRVSTFVVTSALMWVYMIELQESESEITDGDMIYHFVPVADCRERFEFPIPASYFGNCLAFLFISAKRSELMGKEGVVFAAKAIGRKIGELEKGALVGAEKWTSNLNEVVKTGRVLAVGGSPKFGVYETDFGWGRPKKLEFVHFGAYGSFSLAESRDEEGAIEIGLVIGRDKLDLLNVVFQRRLNFNCL

ccccccEEEEEEEEECcccccccccccccccccccccccccccEEEEEccccccccccccHHHHHHHHHHHHcccccccccCEEccccccEEEEccccEEEEEECccccHHHHHcccccccccccccccccccccccccccccccEEEEEEEECcccCEEEEEEEEEEECcHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccccccccccCEEEEEEECcccccccccccccCCcccccccEEEcHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccccccccccccccccEEEEEEcccccEEEEEEcccccccEEEEEEccHHHHHHHHHHHHHHHccccc

*****TV*****S**********PTVIPLTFLDVSWLFCCPIERILFYELPFPTRHLMQNIIPHLKHSLSLTLHHFFPLAGNLACNSKPFIQFNEGDSVRVTVTESDADFGHLVANHLRDNRAFKPLVPKLPFPFPSVSSDNKTPVMAIQVTVFPNSGISIGVTFIHVAADGSSFNHFMKSWASIHKSVTVSETLPPLSLPCHDRNVIKDPNGLLLSIYLKDWRSVHNSDATAPAIDENVQVDNVRVTLVPSRDQIDKLKQ****************STFVVTSALMWVYMIELQESESEITDGDMIYHFVPVADCRERFEFPIPASYFGNCLAFLFISAKRSELMGKEGVVFAAKAIGRKIGELEKGALVGAEKWTSNLNEVVKTGRVLAVGGSPKFGVYETDFGWGRPKKLEFVHFGAYGSFSLAESRDEEGAIEIGLVIGRDKLDLLNVVFQRRLNFNCL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Coumaroyl-CoA:anthocyanidin 3-O-glucoside-6"-O-coumaroyltransferase 1	Involved in the acylation of the 6'' position of the 3-O-glucose residue of anthocyanin. Also able to use flavonol 3-glucosides as the acyl acceptor.	probable	Q9ZWB4
Coumaroyl-CoA:anthocyanidin 3-O-glucoside-6"-O-coumaroyltransferase 2	Involved in the acylation of the 6'' position of the 3-O-glucose residue of anthocyanin. Also able to use flavonol 3-glucosides as the acyl acceptor.	probable	Q9LR73

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XR7, chain A
Confidence level:very confident
Coverage over the Query: 7-461
View the alignment between query and template
View the model in PyMOL