Citrus Sinensis ID: 012456


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460---
MVAVVDSNNLSIPNLNTNGNESRVGYKRSVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQEFWVGNEELVLMYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKQRMWNLSCSAQIENNCNDNMEDSKDCSEKEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQSSS
cEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEEEccHHHHHHHHHHHHHcccccEEEEcccccccccEEEEEEccccEEEEEEEEEccccccHHHHHHccccEEEECccccccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHccccccHHHHccccccccccccccccccccccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHccccccccccHHHHHHHHHcccccHHHHccccccccccccccccccccEEEEccccccHHHHcccccccccccccccEEEEECcEECcccc
**A********************************GYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQEFWVGNEELVLMYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKQRMWNLSCSAQI***************EKEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVAVVDSNNLSIPNLNTNGNESRVGYKRSVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQEFWVGNEELVLMYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKQRMWNLSCSAQIENNCNDNMEDSKDCSEKEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQSSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uncharacterized calcium-binding protein At1g02270 probableO81916

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AAO, chain A
Confidence level:very confident
Coverage over the Query: 304-418
View the alignment between query and template
View the model in PyMOL
Template: 3NGQ, chain A
Confidence level:very confident
Coverage over the Query: 44-320
View the alignment between query and template
View the model in PyMOL
Template: 3PM8, chain A
Confidence level:very confident
Coverage over the Query: 304-451
View the alignment between query and template
View the model in PyMOL