Citrus Sinensis ID: 012482

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460--

MVAVVDSNNLSIPNLNTNGNESRVGYKRSVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQEFWVGNEELVLMYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKRMWNLSCSAQIENNCNDNMEDSKDCSEKEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQSSS

cEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEEEccHHHHHHHHHHHHHcccccEEEEcccccccccEEEEEEccccEEEEEEEEEccccccHHHHHHccccEEEECccccccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHccccccHHHHccccccccccccccccccccccccEEEEEEEEccccccccccHHHHHHHHcHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccccHHHHHHHHcccccHHHHccccccccccccccccccccEEEcccccccHHHHcccccccccccccccEEEEECcEEccccc

*VA********************************GYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQEFWVGNEELVLMYQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKRMWNLSCSA******************KEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQS**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Uncharacterized calcium-binding protein At1g02270		probable	O81916

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NGQ, chain A
Confidence level:very confident
Coverage over the Query: 44-254
View the alignment between query and template
View the model in PyMOL

Template: 2F2O, chain A
Confidence level:very confident
Coverage over the Query: 304-392
View the alignment between query and template
View the model in PyMOL

Template: 3SG6, chain A
Confidence level:very confident
Coverage over the Query: 318-450
View the alignment between query and template
View the model in PyMOL

Template: 3MPR, chain A
Confidence level:confident
Coverage over the Query: 42-61,72-294
View the alignment between query and template
View the model in PyMOL