Citrus Sinensis ID: 012491

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460--

MSFCIHVLLCLIGLILKRSMKKKKFLSLRKLAAGSSVNVLEFTVTQLVCSSHHCSQCSHNPFRLIGVGLSVWTFATAGCGSSFDFWSIAICRMLVGVGEASFISLAAPFIDDNAPVPQKTAWLSMFYMCIPTGVALGYVYGGVVGSHLNWRYAFWGEAILMLPFAVLAFVIKPLQLKGFAPAESGKAQVVASVSEGSEASNLNDHVSEDISDQASERSIKSIGESRFLNQLSQFSQDTKVLLQEKVYVVNVLGYIAYNFVIGAYSYWGPKAGYNIYHMSNADMMFGGVTIVCGIVGTISGGFILDQMGATISNAFKLLSAATFLGAISCLTAFCLSSLYGFLALFTVGELLVFATQAPVNYVCLHSVKPSLRALSMAISTVSIHIFGDVPSSPLVGVLQDHVNNWRKTTLALTSIFFLAAGIWFVGIFLKSIDKFNEDGENQISLDSKANMKPLLEGNGDNL

ccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccc

MSFCIHVLLCLIGLILKRSMKKKKFLSLRKLAAGSSVNVLEFTVTQLVCSSHHCSQCSHNPFRLIGVGLSVWTFATAGCGSSFDFWSIAICRMLVGVGEASFISLAAPFIDDNAPVPQKTAWLSMFYMCIPTGVALGYVYGGVVGSHLNWRYAFWGEAILMLPFAVLAFVIKPLQLKGFAPAESGKAQVVASVSEGSEASNLNDHVS*********RSIKSIGESRFLNQLSQFSQDTKVLLQEKVYVVNVLGYIAYNFVIGAYSYWGPKAGYNIYHMSNADMMFGGVTIVCGIVGTISGGFILDQMGATISNAFKLLSAATFLGAISCLTAFCLSSLYGFLALFTVGELLVFATQAPVNYVCLHSVKPSLRALSMAISTVSIHIFGDVPSSPLVGVLQDHVNNWRKTTLALTSIFFLAAGIWFVGIFLKSIDKF***************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable sphingolipid transporter spinster homolog 2	Probable sphingolipid transporter that plays a central role in endosomes and/or lysosomes storage.	probable	Q9FLG8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PW4, chain A
Confidence level:very confident
Coverage over the Query: 16-190,230-424
View the alignment between query and template
View the model in PyMOL

Template: 4APS, chain A
Confidence level:confident
Coverage over the Query: 16-231,244-423
View the alignment between query and template
View the model in PyMOL

Template: 4GC0, chain A
Confidence level:confident
Coverage over the Query: 35-218,230-444
View the alignment between query and template
View the model in PyMOL