BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 012533
         (461 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2VZX|A Chain A, Structural And Spectroscopic Characterization Of
           Photoconverting Fluorescent Protein Dendra2
 pdb|2VZX|B Chain B, Structural And Spectroscopic Characterization Of
           Photoconverting Fluorescent Protein Dendra2
 pdb|2VZX|C Chain C, Structural And Spectroscopic Characterization Of
           Photoconverting Fluorescent Protein Dendra2
 pdb|2VZX|D Chain D, Structural And Spectroscopic Characterization Of
           Photoconverting Fluorescent Protein Dendra2
 pdb|2VZX|E Chain E, Structural And Spectroscopic Characterization Of
           Photoconverting Fluorescent Protein Dendra2
 pdb|2VZX|F Chain F, Structural And Spectroscopic Characterization Of
           Photoconverting Fluorescent Protein Dendra2
 pdb|2VZX|G Chain G, Structural And Spectroscopic Characterization Of
           Photoconverting Fluorescent Protein Dendra2
 pdb|2VZX|H Chain H, Structural And Spectroscopic Characterization Of
           Photoconverting Fluorescent Protein Dendra2
          Length = 229

 Score = 32.7 bits (73), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 46/114 (40%), Gaps = 21/114 (18%)

Query: 193 DFSICPVLEDLSIDYSLNFDWDADISISSQTLKRLNLMIGGPIVFANEHQATIE-APKLE 251
           D  IC +  D+S++         D    +   K  N    GP++     + T++  P  E
Sbjct: 95  DKGICTIRSDISLE--------GDCFFQNVRFKGTNFPPNGPVM----QKKTLKWEPSTE 142

Query: 252 HLHVNDGTLVSYLVYEL------HSLCDARLDIDYSRVRS--DPVRADHALQLL 297
            LHV DG LV  +   L      H LCD +      +V    D    DH +++L
Sbjct: 143 KLHVRDGLLVGNINMALLLEGGGHYLCDFKTTYKAKKVVQLPDAHFVDHRIEIL 196


>pdb|2EWE|A Chain A, Crystal Structure Of Pectate Lyase C R218k Mutant In
           Complex With Pentagalacturonic Acid
          Length = 353

 Score = 28.5 bits (62), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 51  VWASLPNLMFNDKLCYRRDGTSDNGALTRFENFVDRMLLSNSVSISKFSLHCQKK 105
           VW     L   +  C   DGT DN   T FE+ VD    SN+V++S   +H  KK
Sbjct: 141 VWVDHNELFAANHEC---DGTPDND--TTFESAVDIKGASNTVTVSYNYIHGVKK 190


>pdb|1PLU|A Chain A, Pectate Lyase C From Erwinia Chrysanthemi With 1 Lu+3 Ion
           In The Putative Calcium Binding Site
 pdb|1O88|A Chain A, Pectate Lyase C From Erwinia Chrysanthemi At Ph 11.2 With
           30mm Ca2+
 pdb|1O8D|A Chain A, Pectate Lyase C From Erwinia Chrysanthemi At Ph 11.2 With
           5mm Ca2+
 pdb|1O8E|A Chain A, Pectate Lyase C From Erwinia Chrysanthemi At Ph 11.2 With
           1mm Ca2+
 pdb|1O8F|A Chain A, Pectate Lyase C From Erwinia Chrysanthemi At Ph 9.5 With
           30mm Ca2+
 pdb|1O8G|A Chain A, Pectate Lyase C From Erwinia Chrysanthemi At Ph 9.5 With
           5mm Ca2+
 pdb|1O8H|A Chain A, Pectate Lyase C From Erwinia Chrysanthemi At Ph 9.5 With
           0.3mm Ca2+ Added
 pdb|1O8I|A Chain A, Pectate Lyase C From Erwinia Chrysanthemi At Ph 9.5 With
           No Ca2+ Added
 pdb|1O8J|A Chain A, Pectate Lyase C From Erwinia Chrysanthemi At Ph 4.5 With
           30mm Ca2+
 pdb|1O8K|A Chain A, Pectate Lyase C From Erwinia Chrysanthemi At Ph 4.5 With
           20mm Ca2+
 pdb|1O8L|A Chain A, Pectate Lyase C From Erwinia Chrysanthemi At Ph 4.5 With
           5mm Ca2+
 pdb|1O8M|A Chain A, Pectate Lyase C From Erwinia Chrysanthemi At Ph 4.5 With
           No Ca2+ Added
 pdb|1AIR|A Chain A, Pectate Lyase C From Erwinia Chrysanthemi (Ec16) To A
           Resolution Of 2.2 Angstroms With 128 Waters
 pdb|2PEC|A Chain A, The Refined Three-Dimensional Structure Of Pectate Lyase C
           From Erwinia Chrysanthemi At 2.2 Angstroms Resolution:
           Implications For An Enzymatic Mechanism
          Length = 353

 Score = 28.5 bits (62), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 51  VWASLPNLMFNDKLCYRRDGTSDNGALTRFENFVDRMLLSNSVSISKFSLHCQKK 105
           VW     L   +  C   DGT DN   T FE+ VD    SN+V++S   +H  KK
Sbjct: 141 VWVDHNELFAANHEC---DGTPDND--TTFESAVDIKGASNTVTVSYNYIHGVKK 190


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.140    0.432 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,198,818
Number of Sequences: 62578
Number of extensions: 598486
Number of successful extensions: 1025
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1024
Number of HSP's gapped (non-prelim): 5
length of query: 461
length of database: 14,973,337
effective HSP length: 102
effective length of query: 359
effective length of database: 8,590,381
effective search space: 3083946779
effective search space used: 3083946779
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (25.0 bits)