BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 012537
         (461 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3VDZ|A Chain A, Tailoring Encodable Lanthanide-Binding Tags As Mri
           Contrast Agents: Xq-Dse3-Ubiquitin At 2.4 Angstroms
 pdb|3VDZ|B Chain B, Tailoring Encodable Lanthanide-Binding Tags As Mri
           Contrast Agents: Xq-Dse3-Ubiquitin At 2.4 Angstroms
          Length = 111

 Score = 30.8 bits (68), Expect = 1.5,   Method: Composition-based stats.
 Identities = 12/41 (29%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 171 GEVDSDRDGAVDNEQ---NNDKDNGQELESIVDLQLFIKGL 208
           G +D+D DG++D ++   + D D   + + ++ +Q+F+K L
Sbjct: 3   GYIDTDNDGSIDGDELYIDTDNDGSIDGDELLAMQIFVKTL 43


>pdb|3PG6|A Chain A, The Carboxyl Terminal Domain Of Human Deltex 3-Like
 pdb|3PG6|B Chain B, The Carboxyl Terminal Domain Of Human Deltex 3-Like
 pdb|3PG6|C Chain C, The Carboxyl Terminal Domain Of Human Deltex 3-Like
 pdb|3PG6|D Chain D, The Carboxyl Terminal Domain Of Human Deltex 3-Like
          Length = 159

 Score = 28.5 bits (62), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 236 FTAVYSWVLGIVFVTVCNDLIGKFSSFGG 264
           FT  YS VLG+  V   ND+  K S FGG
Sbjct: 106 FTVGYSRVLGVSDVITWNDIHHKTSRFGG 134


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.141    0.437 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,644,294
Number of Sequences: 62578
Number of extensions: 430094
Number of successful extensions: 1155
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1153
Number of HSP's gapped (non-prelim): 2
length of query: 461
length of database: 14,973,337
effective HSP length: 102
effective length of query: 359
effective length of database: 8,590,381
effective search space: 3083946779
effective search space used: 3083946779
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)