Query         012593
Match_columns 460
No_of_seqs    40 out of 42
Neff          2.4 
Searched_HMMs 46136
Date          Fri Mar 29 04:15:57 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/012593.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/012593hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF15336 Auts2:  Autism suscept  43.6      28  0.0006   34.4   3.7   33  138-173    51-84  (212)
  2 PF01863 DUF45:  Protein of unk  20.0      27 0.00059   31.2  -0.7   11   38-49    136-146 (205)
  3 PRK10984 DNA-binding transcrip  14.2      57  0.0012   30.1  -0.1   11  139-149    17-27  (127)
  4 KOG4226 Adaptor protein NCK/Do  14.0      89  0.0019   32.8   1.2   44  399-442   195-240 (379)
  5 PF07417 Crl:  Transcriptional   13.7      60  0.0013   29.9  -0.1   10  140-149    16-25  (125)
  6 KOG2883 NIPSNAP1 protein [Func  13.7      68  0.0015   32.4   0.3   15  208-222   153-167 (253)
  7 TIGR00187 ribE riboflavin synt   9.7 1.5E+02  0.0033   28.5   1.2   45  294-343    94-138 (200)
  8 COG1451 Predicted metal-depend   9.0 1.1E+02  0.0024   29.6   0.0   12   38-49    147-158 (223)
  9 KOG0905 Phosphoinositide 3-kin   8.9   2E+03   0.043   27.6   9.7   27  217-243   176-203 (1639)
 10 TIGR01358 DAHP_synth_II 3-deox   8.9 1.3E+02  0.0027   32.8   0.3   19  323-341   384-402 (443)

No 1  
>PF15336 Auts2:  Autism susceptibility gene 2 protein
Probab=43.58  E-value=28  Score=34.42  Aligned_cols=33  Identities=39%  Similarity=0.803  Sum_probs=25.5

Q ss_pred             eeeeccCCCCccccCCCccccc-ccCCCCCCCCCCCC
Q 012593          138 IFAIGPYAHETQLVSPPVFSTF-TTEPSTAPFTPPPE  173 (460)
Q Consensus       138 iFAiGPYAhEtQLVSPPVFStf-TTEPSTAPfTPPPE  173 (460)
                      +|+=-+|.|+  |..| .||+. ++-|+++||.|+|-
T Consensus        51 ~f~g~~~phd--LarP-Lfs~tG~~hPs~~Pfgp~ph   84 (212)
T PF15336_consen   51 VFGGLHYPHD--LARP-LFSATGAAHPSANPFGPSPH   84 (212)
T ss_pred             ccCCCCCccc--cCcc-ccCCCCCCCCCCCCCCCCCC
Confidence            6666678887  4444 88776 89999999999883


No 2  
>PF01863 DUF45:  Protein of unknown function DUF45;  InterPro: IPR002725 Members of this family are found in some archaebacteria, as well as Helicobacter pylori. The proteins are 190-240 amino acids long, with the C terminus being the most conserved region, containing three conserved histidines.
Probab=19.99  E-value=27  Score=31.21  Aligned_cols=11  Identities=55%  Similarity=1.220  Sum_probs=9.1

Q ss_pred             hhcccccccccc
Q 012593           38 SQKRRWGGCWSI   49 (460)
Q Consensus        38 ~~k~RWg~c~s~   49 (460)
                      ..|+|||+| +.
T Consensus       136 ~~ksrWGsc-~~  146 (205)
T PF01863_consen  136 DMKSRWGSC-SS  146 (205)
T ss_pred             ehhhccccC-CC
Confidence            589999999 54


No 3  
>PRK10984 DNA-binding transcriptional regulator Crl; Provisional
Probab=14.15  E-value=57  Score=30.10  Aligned_cols=11  Identities=55%  Similarity=0.896  Sum_probs=6.9

Q ss_pred             eeeccCCCCcc
Q 012593          139 FAIGPYAHETQ  149 (460)
Q Consensus       139 FAiGPYAhEtQ  149 (460)
                      =|||||-+|.|
T Consensus        17 ~alGPYlRE~q   27 (127)
T PRK10984         17 TALGPYLREGQ   27 (127)
T ss_pred             HHhCchhchhc
Confidence            35666666665


No 4  
>KOG4226 consensus Adaptor protein NCK/Dock, contains SH2 and SH3 domains [Signal transduction mechanisms]
Probab=13.98  E-value=89  Score=32.75  Aligned_cols=44  Identities=18%  Similarity=0.404  Sum_probs=37.3

Q ss_pred             ccccccccccccccccCCCC--CCCCCCCccccccccceecccCCC
Q 012593          399 QKQQSITLGSTKEFNFDSAD--GDSHEPTIASDWWANEKVVGKDSG  442 (460)
Q Consensus       399 ~K~~sitlgs~KEFnFdN~~--~~s~~p~i~sdWWaNekVagke~~  442 (460)
                      +-+-+++-.+..|.+|.--+  +.+++|..-.|||--.+.-|..+-
T Consensus       195 vaLYsFsssndeELsFeKGerleivd~Pe~DPdWwkarn~~G~vGL  240 (379)
T KOG4226|consen  195 VALYSFSSSNDEELSFEKGERLEIVDKPENDPDWWKARNARGQVGL  240 (379)
T ss_pred             EEEecccCCChhhcccccCceeEeccCCCCCchHHhhcccCCccce
Confidence            44678888888999999999  999999999999998888777554


No 5  
>PF07417 Crl:  Transcriptional regulator Crl;  InterPro: IPR009986 This family contains the bacterial transcriptional regulator Crl (approximately 130 residues long). This is a transcriptional regulator of the csgA curlin subunit gene for curli fibres that are found on the surface of certain bacteria [].These proteins bind to the sigma-S subunit of RNA polymerase, activating expression of sigma-S-regulated genes. They also stimulate RNA polymerase holoenzyme formation and may bind to several other sigma factors, such as sigma-70 and sigma-32.; GO: 0016987 sigma factor activity, 0045893 positive regulation of transcription, DNA-dependent, 0005737 cytoplasm; PDB: 3RPJ_A.
Probab=13.68  E-value=60  Score=29.94  Aligned_cols=10  Identities=60%  Similarity=1.059  Sum_probs=5.8

Q ss_pred             eeccCCCCcc
Q 012593          140 AIGPYAHETQ  149 (460)
Q Consensus       140 AiGPYAhEtQ  149 (460)
                      |||||-+|-|
T Consensus        16 alGPYlRE~q   25 (125)
T PF07417_consen   16 ALGPYLREGQ   25 (125)
T ss_dssp             TT-TTB-GGG
T ss_pred             hhCchhcccc
Confidence            6777777766


No 6  
>KOG2883 consensus NIPSNAP1 protein [Function unknown]
Probab=13.66  E-value=68  Score=32.44  Aligned_cols=15  Identities=47%  Similarity=1.021  Sum_probs=13.4

Q ss_pred             cccccccccCCCCCC
Q 012593          208 YYEFQSYHLHPGSPV  222 (460)
Q Consensus       208 ~ye~qsYqlyPGSP~  222 (460)
                      -|||.+|||-||-++
T Consensus       153 vYELrsy~lkPGtmi  167 (253)
T KOG2883|consen  153 VYELRSYQLKPGTMI  167 (253)
T ss_pred             ceeeeeEecCCCchh
Confidence            389999999999876


No 7  
>TIGR00187 ribE riboflavin synthase, alpha subunit. The name ribE was selected, from among alternatives including ribB and ribC, to match the usage in EcoCyc.
Probab=9.74  E-value=1.5e+02  Score=28.49  Aligned_cols=45  Identities=18%  Similarity=0.276  Sum_probs=34.5

Q ss_pred             CCCccccccceeccccCCCCCCCcccccccceeeeeechhhhhhhhccCc
Q 012593          294 RNGFFQNRQISEVALRPHSENGLRKDQIVDHRVSFELTTEDVVRCVEKKP  343 (460)
Q Consensus       294 ~~g~~l~~qis~vas~~~s~~~~~~~~~~~HrVSFeLt~edv~rcle~K~  343 (460)
                      .+|+++.+||..++.+..-+....     .+++.|++..++.+|.+-.|-
T Consensus        94 lgGH~V~GHVd~~~~i~~~~~~~~-----~~~~~~~~~p~~~~~yiv~KG  138 (200)
T TIGR00187        94 IGGHFVSGHIDTTAEIAKIETSEN-----NVQFWFKLQDSELMKYIVEKG  138 (200)
T ss_pred             cCCeeEeEEccEEEEEEEEEEcCC-----cEEEEEEECCHHHHhccccCC
Confidence            678999999999998877665543     678889985567788766664


No 8  
>COG1451 Predicted metal-dependent hydrolase [General function prediction only]
Probab=8.99  E-value=1.1e+02  Score=29.58  Aligned_cols=12  Identities=50%  Similarity=1.143  Sum_probs=9.9

Q ss_pred             hhcccccccccc
Q 012593           38 SQKRRWGGCWSI   49 (460)
Q Consensus        38 ~~k~RWg~c~s~   49 (460)
                      ..|+|||||-..
T Consensus       147 ~~k~~WGScs~~  158 (223)
T COG1451         147 NMKRRWGSCSKA  158 (223)
T ss_pred             eccceeeeecCC
Confidence            689999999743


No 9  
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms]
Probab=8.91  E-value=2e+03  Score=27.62  Aligned_cols=27  Identities=33%  Similarity=0.477  Sum_probs=19.0

Q ss_pred             CCCCCCCCc-cCCCCccCCCCCCCCCCC
Q 012593          217 HPGSPVGNL-ISPSSGISGSGTSSPFPD  243 (460)
Q Consensus       217 yPGSP~g~L-ISP~S~~s~sGtSSPfPd  243 (460)
                      +|+||.... +|+.|-.++.....|||.
T Consensus       176 ~~~Sp~sp~h~sqps~~s~~s~~a~~~~  203 (1639)
T KOG0905|consen  176 RPQSPPSPIHHSQPSDSSTFSHVAPFPA  203 (1639)
T ss_pred             CCCCCCCCCCCCCCCCCccccccCCchh
Confidence            455554444 888887787788888875


No 10 
>TIGR01358 DAHP_synth_II 3-deoxy-7-phosphoheptulonate synthase, class II. Homologs scoring between trusted and noise cutoff include proteins involved in antibiotic biosynthesis; one example is active as this enzyme, while another acts on an amino analog.
Probab=8.85  E-value=1.3e+02  Score=32.81  Aligned_cols=19  Identities=42%  Similarity=0.608  Sum_probs=16.2

Q ss_pred             cceeeeeechhhhhhhhcc
Q 012593          323 DHRVSFELTTEDVVRCVEK  341 (460)
Q Consensus       323 ~HrVSFeLt~edv~rcle~  341 (460)
                      .=-|-+|||+|||-.|+.-
T Consensus       384 ~GGlHlE~Tg~dVTEC~Gg  402 (443)
T TIGR01358       384 PGGVHLELTGEDVTECLGG  402 (443)
T ss_pred             CCeEEEEecCCCcceeCCC
Confidence            3368999999999999974


Done!