Citrus Sinensis ID: 012608


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460
MSEVDGLPSFREFTLEQLKNATSGFAVENIVSEHGEKAPNVVYKGKLENQRRIAVKRFNRMAWPDPRQFLEEARSVGQLRNNRLTNLLGCCCEGDERLLVAEYMPNETLAKHLFHWETHPMKWAMRLRVVLHLAQALEYCTSKGRALYHDLNAYRILFDEDGNPRLSTFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQMLTDSCLEGQFTDDDGTELVRLASRCLQYEPRERPNPKSLVTALSPLQKETEVPSHVLMGIPHSASVSPLSPLGEACSRRDLTAIHEILEKISYKDDEGVANELSFQMWTDQMQETLNSKKKGDVAFRQKDLKDAIECYTQFIDAGTMVSPTVYARRSLCYLMSDMPQDALNDAMQAQIISPIWHIASYLQAAALSAMGMENEAQVALKEGTTLEAKKNSTAGQK
ccccccccccccccHHHHHHHHccccccccccccccccccccEEEEEccccEEEEEEccccccccHHHHHHHHHHHHHcccccccccccccccccEEEEEEEEcccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEccccccHHHHHHcccccccccEEEHHHHHHHHHccccccccHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHccccccHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccc
cccccccccccEccHHHHHHHHccccHHccEccccccccccEEEcEcccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHEEEEEcccccEEEEEEEcccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccEEEEcccHcHEEEcccccccHcHccHHEEcccccEEEEEcccccHHHHHccccccccHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHccHHHcccccHHHHHHHHHHHHHHHHccHcccccHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccc
msevdglpsfrEFTLEQLKNATSGFAVENIVsehgekapnvvykgkleNQRRIAVKRFnrmawpdprQFLEEARSVGQLRNNrltnllgcccegderllvaeympnetLAKHLFHWETHPMKWAMRLRVVLHLAQALEYCTSKGRALYHDLNAYRIlfdedgnprlstfglmknsrdgksystnlaftppeylrtgrvtpesvIYSFGTLLLDLlsgkhippshaldliRDRNLQMLTdsclegqftdddGTELVRLASRclqyeprerpnpkslVTALsplqketevpshvlmgiphsasvsplsplgeacsrrDLTAIHEILEKisykddegvaNELSFQMWTDQMQETLNSKKKGDVAFRQKDLKDAIECYTQFIdagtmvspTVYARRSLCYLMSDMPQDALNDAMQAQIISPIWHIASYLQAAALSAMGMENEAQVALKEGTtleakknstagqk
msevdglpsfREFTLEQLKNATSGFAVENIVsehgekapnvvykgklenQRRIAVKRfnrmawpdprQFLEEARSVGQLRNNRLTNLLGCCCEGDERLLVAEYMPNETLAKHLFHWETHPMKWAMRLRVVLHLAQALEYCTSKGRALYHDLNAYRILFDEDGNPRLSTFGLMknsrdgksystnlaftppeylrtgrvTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQMLTDSCLEgqftdddgtELVRLASRClqyeprerpnpksLVTALSPLQKETEVPSHVLMGIPHSASVSPLSPLGEACSRRDLTAIHEILekisykddegVANELSFQMWTDQMQETLNSKKKGDVAFRQKDLKDAIECYTQfidagtmvsPTVYARRSLCYLMSDMPQDALNDAMQAQIISPIWHIASYLQAAALSAMGMENEAQVALkegttleakknstagqk
MSEVDGLPSFREFTLEQLKNATSGFAVENIVSEHGEKAPNVVYKGKLENQRRIAVKRFNRMAWPDPRQFLEEARSVGQLRNNRLTNLLGCCCEGDERLLVAEYMPNETLAKHLFHWETHPMKWAMRLRVVLHLAQALEYCTSKGRALYHDLNAYRILFDEDGNPRLSTFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQMLTDSCLEGQFTDDDGTELVRLASRCLQYEPRERPNPKSLVTALSPLQKETEVPSHVLMGIPHSASVSPLSPLGEACSRRDLTAIHEILEKISYKDDEGVANELSFQMWTDQMQETLNSKKKGDVAFRQKDLKDAIECYTQFIDAGTMVSPTVYARRSLCYLMSDMPQDALNDAMQAQIISPIWHIASYLQAAALSAMGMENEAQVALKEGTTLEAKKNSTAGQK
*****************LKNATSGFAVENIVSEHGEKAPNVVYKGKLENQRRIAVKRFNRMAWPDPRQFLEEARSVGQLRNNRLTNLLGCCCEGDERLLVAEYMPNETLAKHLFHWETHPMKWAMRLRVVLHLAQALEYCTSKGRALYHDLNAYRILFDEDGNPRLSTFGL**********STNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQMLTDSCLEGQFTDDDGTELVRLASRCLQ************************************************CSRRDLTAIHEILEKISYKDDEGVANELSFQMWTD*************VAFRQKDLKDAIECYTQFIDAGTMVSPTVYARRSLCYLMSDMPQDALNDAMQAQIISPIWHIASYLQAAALSAM***************************
********SFREFTLEQLKNATSGFAVENIVSEHGEKAPNVVYKGKLENQRRIAVKRFNRMAWPDPRQFLEEARSVGQLRNNRLTNLLGCCCEGDERLLVAEYMPNETLAKHLFHWETHPMKWAMRLRVVLHLAQALEYCTSKGRALYHDLNAYRILFDEDGNPRLSTFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQMLTDSCLEGQFTDDDGTELVRLASRCLQYEPRERPNPKSLVTALSP**********************************************************************************QKDLKDAIECYTQFIDAGTMVSPTVYARRSLCYLMSDMPQDALNDAMQAQIISPIWHIASYLQAAALSAMGMENEAQVAL*****************
MSEVDGLPSFREFTLEQLKNATSGFAVENIVSEHGEKAPNVVYKGKLENQRRIAVKRFNRMAWPDPRQFLEEARSVGQLRNNRLTNLLGCCCEGDERLLVAEYMPNETLAKHLFHWETHPMKWAMRLRVVLHLAQALEYCTSKGRALYHDLNAYRILFDEDGNPRLSTFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQMLTDSCLEGQFTDDDGTELVRLASRCLQYEPRERPNPKSLVTALSPLQKETEVPSHVLMGIPHSASVSPLSPLGEACSRRDLTAIHEILEKISYKDDEGVANELSFQMWTDQMQETLNSKKKGDVAFRQKDLKDAIECYTQFIDAGTMVSPTVYARRSLCYLMSDMPQDALNDAMQAQIISPIWHIASYLQAAALSAMGMENEAQVALKEGTTLE**********
*****GLPSFREFTLEQLKNATSGFAVENIVSEHGEKAPNVVYKGKLENQRRIAVKRFNRMAWPDPRQFLEEARSVGQLRNNRLTNLLGCCCEGDERLLVAEYMPNETLAKHLFHWETHPMKWAMRLRVVLHLAQALEYCTSKGRALYHDLNAYRILFDEDGNPRLSTFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQMLTDSCLEGQFTDDDGTELVRLASRCLQYEPRERPNPKSLVTALSPLQKETEVPSHVLMGIP**************CSRRDLTAIHEILEKISYKDDEGVANELSFQMWTDQMQETLNSKKKGDVAFRQKDLKDAIECYTQFIDAGTMVSPTVYARRSLCYLMSDMPQDALNDAMQAQIISPIWHIASYLQAAALSAMGMENEAQVALKEGTTLEAK********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEVDGLPSFREFTLEQLKNATSGFAVENIVSEHGEKAPNVVYKGKLENQRRIAVKRFNRMAWPDPRQFLEEARSVGQLRNNRLTNLLGCCCEGDERLLVAEYMPNETLAKHLFHWETHPMKWAMRLRVVLHLAQALEYCTSKGRALYHDLNAYRILFDEDGNPRLSTFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQMLTDSCLEGQFTDDDGTELVRLASRCLQYEPRERPNPKSLVTALSPLQKETEVPSHVLMGIPHSASVSPLSPLGEACSRRDLTAIHEILEKISYKDDEGVANELSFQMWTDQMQETLNSKKKGDVAFRQKDLKDAIECYTQFIDAGTMVSPTVYARRSLCYLMSDMPQDALNDAMQAQIISPIWHIASYLQAAALSAMGMENEAQVALKEGTTLEAKKNSTAGQK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query460 2.2.26 [Sep-21-2011]
Q9FHD7487 Probable serine/threonine no no 0.982 0.928 0.798 0.0
Q944A7512 Probable serine/threonine no no 0.969 0.871 0.652 0.0
Q7XJT7465 Probable inactive recepto no no 0.932 0.922 0.468 1e-117
Q06548410 Protein kinase APK1A, chl no no 0.593 0.665 0.328 2e-37
P46573412 Protein kinase APK1B, chl no no 0.602 0.672 0.334 3e-37
Q8H186389 Probable receptor-like pr no no 0.610 0.722 0.316 1e-36
O49839426 Protein kinase 2A, chloro no no 0.65 0.701 0.313 3e-36
O48814395 Serine/threonine-protein no no 0.604 0.703 0.320 4e-36
O49840426 Protein kinase 2B, chloro no no 0.606 0.654 0.308 2e-35
Q9CAH1450 Putative receptor-like pr no no 0.669 0.684 0.302 2e-35
>sp|Q9FHD7|Y5126_ARATH Probable serine/threonine-protein kinase At5g41260 OS=Arabidopsis thaliana GN=At5g41260 PE=1 SV=1 Back     alignment and function desciption
 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/452 (79%), Positives = 407/452 (90%)

Query: 3   EVDGLPSFREFTLEQLKNATSGFAVENIVSEHGEKAPNVVYKGKLENQRRIAVKRFNRMA 62
           E + LP FREF++E ++NATSGFA ENIVSEHGE+APNVVYKGKLENQRRIAVKRFNR +
Sbjct: 34  ESNDLPQFREFSIETIRNATSGFAAENIVSEHGERAPNVVYKGKLENQRRIAVKRFNRKS 93

Query: 63  WPDPRQFLEEARSVGQLRNNRLTNLLGCCCEGDERLLVAEYMPNETLAKHLFHWETHPMK 122
           WPD RQFLEEA++VGQLRN+R+ NLLGCC E +ERLL+AE+MPNETLAKHLFHWE+ PMK
Sbjct: 94  WPDSRQFLEEAKAVGQLRNHRMANLLGCCYEDEERLLIAEFMPNETLAKHLFHWESQPMK 153

Query: 123 WAMRLRVVLHLAQALEYCTSKGRALYHDLNAYRILFDEDGNPRLSTFGLMKNSRDGKSYS 182
           WAMRLRV LH+AQALEYCTSKGRALYHDLNAYR+LFD+D NPRLS FGLMKNSRDGKSYS
Sbjct: 154 WAMRLRVALHIAQALEYCTSKGRALYHDLNAYRVLFDDDANPRLSCFGLMKNSRDGKSYS 213

Query: 183 TNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQMLTDSCL 242
           TNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRN+QML DS L
Sbjct: 214 TNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNIQMLMDSGL 273

Query: 243 EGQFTDDDGTELVRLASRCLQYEPRERPNPKSLVTALSPLQKETEVPSHVLMGIPHSASV 302
           EGQF+ DDGTEL+RLASRCLQYEPRERPNPKSLV+A+ PLQK+ E+ SH L+G+P+SA+ 
Sbjct: 274 EGQFSSDDGTELIRLASRCLQYEPRERPNPKSLVSAMIPLQKDLEIASHQLLGVPNSATT 333

Query: 303 SPLSPLGEACSRRDLTAIHEILEKISYKDDEGVANELSFQMWTDQMQETLNSKKKGDVAF 362
           + LSPLGEAC R DLTAIHEI+EK+ YKDDEG   ELSFQMWTDQMQ+TL  KKKGD AF
Sbjct: 334 TALSPLGEACLRSDLTAIHEIIEKLGYKDDEGATTELSFQMWTDQMQDTLVFKKKGDSAF 393

Query: 363 RQKDLKDAIECYTQFIDAGTMVSPTVYARRSLCYLMSDMPQDALNDAMQAQIISPIWHIA 422
           R KD   AIECY+QFI+ GTM SPTV+AR+SLCYLM+DMP++ALN+AMQAQ+ISP WHIA
Sbjct: 394 RHKDFAKAIECYSQFIEVGTMGSPTVHARQSLCYLMNDMPREALNNAMQAQVISPAWHIA 453

Query: 423 SYLQAAALSAMGMENEAQVALKEGTTLEAKKN 454
           SYLQA ALSA+G ENEA  ALK+G  LE+K+N
Sbjct: 454 SYLQAVALSALGQENEAHTALKDGAMLESKRN 485





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q944A7|Y4523_ARATH Probable serine/threonine-protein kinase At4g35230 OS=Arabidopsis thaliana GN=At4g35230 PE=1 SV=1 Back     alignment and function description
>sp|Q7XJT7|SSP_ARATH Probable inactive receptor-like kinase SSP OS=Arabidopsis thaliana GN=SSP PE=1 SV=1 Back     alignment and function description
>sp|Q06548|APK1A_ARATH Protein kinase APK1A, chloroplastic OS=Arabidopsis thaliana GN=APK1A PE=2 SV=1 Back     alignment and function description
>sp|P46573|APK1B_ARATH Protein kinase APK1B, chloroplastic OS=Arabidopsis thaliana GN=APK1B PE=2 SV=2 Back     alignment and function description
>sp|Q8H186|Y3545_ARATH Probable receptor-like protein kinase At3g55450 OS=Arabidopsis thaliana GN=At3g55450 PE=1 SV=1 Back     alignment and function description
>sp|O49839|APK2A_ARATH Protein kinase 2A, chloroplastic OS=Arabidopsis thaliana GN=APK2A PE=2 SV=1 Back     alignment and function description
>sp|O48814|BIK1_ARATH Serine/threonine-protein kinase BIK1 OS=Arabidopsis thaliana GN=BIK1 PE=1 SV=1 Back     alignment and function description
>sp|O49840|APK2B_ARATH Protein kinase 2B, chloroplastic OS=Arabidopsis thaliana GN=APK2B PE=1 SV=1 Back     alignment and function description
>sp|Q9CAH1|Y1725_ARATH Putative receptor-like protein kinase At1g72540 OS=Arabidopsis thaliana GN=At1g72540 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query460
225454188491 PREDICTED: probable serine/threonine-pro 0.997 0.934 0.897 0.0
356520418491 PREDICTED: probable serine/threonine-pro 0.997 0.934 0.880 0.0
255541562493 receptor protein kinase, putative [Ricin 0.997 0.931 0.877 0.0
356504529491 PREDICTED: probable serine/threonine-pro 0.989 0.926 0.881 0.0
224127648491 predicted protein [Populus trichocarpa] 0.997 0.934 0.869 0.0
224064025491 predicted protein [Populus trichocarpa] 0.997 0.934 0.860 0.0
357507281492 hypothetical protein MTR_7g077150 [Medic 0.995 0.930 0.849 0.0
225426412488 PREDICTED: probable serine/threonine-pro 0.991 0.934 0.857 0.0
297814269490 kinase family protein [Arabidopsis lyrat 0.984 0.924 0.850 0.0
22328189489 BR-signaling kinase 3 [Arabidopsis thali 0.982 0.924 0.852 0.0
>gi|225454188|ref|XP_002272416.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 [Vitis vinifera] gi|297745267|emb|CBI40347.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/459 (89%), Positives = 434/459 (94%)

Query: 2   SEVDGLPSFREFTLEQLKNATSGFAVENIVSEHGEKAPNVVYKGKLENQRRIAVKRFNRM 61
           SEVD LP F E+T EQLKNATSGFAVENIVSEHGEKAPNVVYKGKLENQRRIAVKRFNR+
Sbjct: 33  SEVDYLPVFCEYTFEQLKNATSGFAVENIVSEHGEKAPNVVYKGKLENQRRIAVKRFNRV 92

Query: 62  AWPDPRQFLEEARSVGQLRNNRLTNLLGCCCEGDERLLVAEYMPNETLAKHLFHWETHPM 121
           AWPD RQF EEAR+VGQLRN+RL NLLGCCCE +ERLLVAEYMPNETLAKHLFHWET PM
Sbjct: 93  AWPDARQFSEEARAVGQLRNHRLANLLGCCCEDNERLLVAEYMPNETLAKHLFHWETQPM 152

Query: 122 KWAMRLRVVLHLAQALEYCTSKGRALYHDLNAYRILFDEDGNPRLSTFGLMKNSRDGKSY 181
           KWAMRLRVVLHLAQALEYCT +GRALYHDLNAYRILFDEDGNPRLS FGLMKNSRDGKSY
Sbjct: 153 KWAMRLRVVLHLAQALEYCTGRGRALYHDLNAYRILFDEDGNPRLSCFGLMKNSRDGKSY 212

Query: 182 STNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQMLTDSC 241
           STNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQMLTDSC
Sbjct: 213 STNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQMLTDSC 272

Query: 242 LEGQFTDDDGTELVRLASRCLQYEPRERPNPKSLVTALSPLQKETEVPSHVLMGIPHSAS 301
           LEGQFT+DDGTELVRLASRCLQYEPRERPNPKSLV AL+PLQKETEVPSHVLMGIPHSAS
Sbjct: 273 LEGQFTNDDGTELVRLASRCLQYEPRERPNPKSLVAALTPLQKETEVPSHVLMGIPHSAS 332

Query: 302 VSPLSPLGEACSRRDLTAIHEILEKISYKDDEGVANELSFQMWTDQMQETLNSKKKGDVA 361
            SPLSPLGEACSR DLTAIHEILE + YKDDEG+ NELSFQMWTDQMQETLNSKKKGD A
Sbjct: 333 FSPLSPLGEACSRMDLTAIHEILESVGYKDDEGMTNELSFQMWTDQMQETLNSKKKGDAA 392

Query: 362 FRQKDLKDAIECYTQFIDAGTMVSPTVYARRSLCYLMSDMPQDALNDAMQAQIISPIWHI 421
           FRQKD + AI+CYTQFID GTMVSPTV ARRSLCYLMSDMPQ+ALNDAMQAQ+ISP+WHI
Sbjct: 393 FRQKDFRAAIDCYTQFIDVGTMVSPTVCARRSLCYLMSDMPQEALNDAMQAQVISPVWHI 452

Query: 422 ASYLQAAALSAMGMENEAQVALKEGTTLEAKKNSTAGQK 460
           ASYLQAAAL+ +GMENEAQ ALK+GTTLEA++N+ +GQK
Sbjct: 453 ASYLQAAALTGLGMENEAQAALKDGTTLEAQRNTPSGQK 491




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356520418|ref|XP_003528859.1| PREDICTED: probable serine/threonine-protein kinase At5g41260-like [Glycine max] Back     alignment and taxonomy information
>gi|255541562|ref|XP_002511845.1| receptor protein kinase, putative [Ricinus communis] gi|223549025|gb|EEF50514.1| receptor protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356504529|ref|XP_003521048.1| PREDICTED: probable serine/threonine-protein kinase At5g41260-like [Glycine max] Back     alignment and taxonomy information
>gi|224127648|ref|XP_002320126.1| predicted protein [Populus trichocarpa] gi|222860899|gb|EEE98441.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224064025|ref|XP_002301354.1| predicted protein [Populus trichocarpa] gi|222843080|gb|EEE80627.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357507281|ref|XP_003623929.1| hypothetical protein MTR_7g077150 [Medicago truncatula] gi|355498944|gb|AES80147.1| hypothetical protein MTR_7g077150 [Medicago truncatula] Back     alignment and taxonomy information
>gi|225426412|ref|XP_002270065.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 [Vitis vinifera] gi|297742525|emb|CBI34674.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297814269|ref|XP_002875018.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297320855|gb|EFH51277.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|22328189|ref|NP_191980.2| BR-signaling kinase 3 [Arabidopsis thaliana] gi|17064838|gb|AAL32573.1| Unknown protein [Arabidopsis thaliana] gi|20259854|gb|AAM13274.1| unknown protein [Arabidopsis thaliana] gi|332656524|gb|AEE81924.1| BR-signaling kinase 3 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query460
TAIR|locus:2127118489 BSK3 "brassinosteroid-signalin 0.982 0.924 0.852 2.1e-212
TAIR|locus:2031279487 BSK7 "brassinosteroid-signalin 0.982 0.928 0.827 2.8e-208
TAIR|locus:2155115487 BSK8 "brassinosteroid-signalin 0.982 0.928 0.798 2.8e-201
TAIR|locus:2154538489 BSK5 "brassinosteroid-signalin 0.978 0.920 0.769 2.2e-192
TAIR|locus:2084475490 BSK6 "brassinosteroid-signalin 0.973 0.914 0.746 1.4e-183
TAIR|locus:2198160483 BSK4 "brassinosteroid-signalin 0.980 0.933 0.740 1.3e-180
TAIR|locus:2122058512 BSK1 "brassinosteroid-signalin 0.971 0.873 0.653 5e-163
TAIR|locus:2142315489 BSK2 "brassinosteroid-signalin 0.986 0.928 0.606 7.4e-153
TAIR|locus:2083499477 BSK9 "brassinosteroid-signalin 0.965 0.930 0.626 7.9e-149
TAIR|locus:2150074499 BSK10 "brassinosteroid-signali 0.960 0.885 0.603 1.7e-144
TAIR|locus:2127118 BSK3 "brassinosteroid-signaling kinase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2053 (727.8 bits), Expect = 2.1e-212, P = 2.1e-212
 Identities = 386/453 (85%), Positives = 422/453 (93%)

Query:     2 SEVDGLPSFREFTLEQLKNATSGFAVENIVSEHGEKAPNVVYKGKLENQRRIAVKRFNRM 61
             SE+  +P+FRE+TLEQLK ATSGFAVE IVSEHGEKAPNVVYKGKLENQ++IAVKRF RM
Sbjct:    32 SEITDVPNFREYTLEQLKAATSGFAVEYIVSEHGEKAPNVVYKGKLENQKKIAVKRFTRM 91

Query:    62 AWPDPRQFLEEARSVGQLRNNRLTNLLGCCCEGDERLLVAEYMPNETLAKHLFHWETHPM 121
             AWPD RQFLEEARSVGQLR+ R+ NLLGCCCEGDERLLVAE+MPNETLAKHLFHWET PM
Sbjct:    92 AWPDSRQFLEEARSVGQLRSERMANLLGCCCEGDERLLVAEFMPNETLAKHLFHWETQPM 151

Query:   122 KWAMRLRVVLHLAQALEYCTSKGRALYHDLNAYRILFDEDGNPRLSTFGLMKNSRDGKSY 181
             KW MRLRVVL+LAQALEYCTSKGR LYHDLNAYR+LFDE+ NPRLSTFGLMKNSRDGKSY
Sbjct:   152 KWTMRLRVVLYLAQALEYCTSKGRTLYHDLNAYRVLFDEECNPRLSTFGLMKNSRDGKSY 211

Query:   182 STNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQMLTDSC 241
             STNLAFTPPEYLRTGR+TPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQ LTDSC
Sbjct:   212 STNLAFTPPEYLRTGRITPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQTLTDSC 271

Query:   242 LEGQFTDDDGTELVRLASRCLQYEPRERPNPKSLVTALSPLQKETEVPSHVLMGIPHSAS 301
             L+GQF+D DGTELVRLASRCLQYE RERPN KSLVTAL+PLQKETEV SHVLMG+PHS S
Sbjct:   272 LDGQFSDSDGTELVRLASRCLQYEARERPNTKSLVTALTPLQKETEVLSHVLMGLPHSGS 331

Query:   302 VSPLSPLGEACSRRDLTAIHEILEKISYKDDEGVANELSFQMWTDQMQETLNSKKKGDVA 361
             VSPLSPLGEACSRRDLTA+ EILEK+ YKDDEGV NELSF MWTDQMQE+LNSKKKGDVA
Sbjct:   332 VSPLSPLGEACSRRDLTAMLEILEKLGYKDDEGVTNELSFHMWTDQMQESLNSKKKGDVA 391

Query:   362 FRQKDLKDAIECYTQFIDAGTMVSPTVYARRSLCYLMSDMPQDALNDAMQAQIISPIWHI 421
             FRQKD ++AIECYTQFID G M+SPTV ARRSLCYLMSDMP++AL+DA+QAQ+ISP+WH+
Sbjct:   392 FRQKDFREAIECYTQFIDGG-MISPTVCARRSLCYLMSDMPKEALDDAIQAQVISPVWHV 450

Query:   422 ASYLQAAALSAMGMENEAQVALKEGTTLEAKKN 454
             ASYLQ+A+L  +GME E+Q+ALKEG+ LEAK N
Sbjct:   451 ASYLQSASLGILGMEKESQIALKEGSNLEAKMN 483




GO:0004672 "protein kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0016020 "membrane" evidence=IDA
GO:0009742 "brassinosteroid mediated signaling pathway" evidence=IMP
GO:0009506 "plasmodesma" evidence=IDA
TAIR|locus:2031279 BSK7 "brassinosteroid-signaling kinase 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155115 BSK8 "brassinosteroid-signaling kinase 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154538 BSK5 "brassinosteroid-signaling kinase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084475 BSK6 "brassinosteroid-signaling kinase 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198160 BSK4 "brassinosteroid-signaling kinase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122058 BSK1 "brassinosteroid-signaling kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142315 BSK2 "brassinosteroid-signaling kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083499 BSK9 "brassinosteroid-signaling kinase 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150074 BSK10 "brassinosteroid-signaling kinase 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FHD7Y5126_ARATH2, ., 7, ., 1, 1, ., 10.79860.98260.9281nono

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00026835001
SubName- Full=Chromosome chr15 scaffold_40, whole genome shotgun sequence; (491 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query460
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 5e-29
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 5e-23
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 3e-22
pfam00069260 pfam00069, Pkinase, Protein kinase domain 5e-22
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 2e-21
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 3e-21
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 2e-19
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 3e-19
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 5e-17
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 8e-16
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 3e-15
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 1e-14
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 1e-14
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 4e-14
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 4e-13
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 5e-12
cd05078258 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 7e-12
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 9e-12
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 2e-11
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 2e-11
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 3e-11
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 3e-11
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 3e-11
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 5e-11
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 6e-11
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 7e-11
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 8e-11
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 8e-11
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 2e-10
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 4e-10
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-10
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 1e-09
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 1e-09
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 1e-09
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 2e-09
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 2e-09
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 3e-09
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 3e-09
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 7e-09
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 8e-09
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 1e-08
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 2e-08
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 2e-08
cd05037259 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom 2e-08
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 2e-08
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 4e-08
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 4e-08
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 6e-08
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 8e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-07
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 2e-07
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 2e-07
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 3e-07
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 3e-07
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 5e-07
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 5e-07
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 6e-07
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 6e-07
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-07
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 6e-07
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 7e-07
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 8e-07
cd05096304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 1e-06
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 2e-06
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 2e-06
cd05076274 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) do 3e-06
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 3e-06
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 3e-06
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 3e-06
cd05077262 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) do 3e-06
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 4e-06
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 4e-06
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 4e-06
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 8e-06
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 1e-05
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 1e-05
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 1e-05
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 1e-05
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 1e-05
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 1e-05
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 1e-05
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 1e-05
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 1e-05
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 2e-05
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 2e-05
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 2e-05
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 2e-05
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 2e-05
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 2e-05
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 3e-05
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 3e-05
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 4e-05
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 5e-05
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 5e-05
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 5e-05
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 5e-05
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 6e-05
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 6e-05
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 7e-05
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 7e-05
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 8e-05
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 1e-04
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 1e-04
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 2e-04
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 2e-04
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 2e-04
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 2e-04
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 2e-04
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 3e-04
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 3e-04
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 3e-04
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 4e-04
cd06650333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 4e-04
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 4e-04
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 7e-04
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 7e-04
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 8e-04
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 0.001
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 0.001
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 0.001
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 0.001
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 0.001
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 0.001
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 0.002
cd06649331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 0.002
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 0.003
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 0.003
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 0.003
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 0.003
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 0.003
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 0.003
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 0.004
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 0.004
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 0.004
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
 Score =  113 bits (284), Expect = 5e-29
 Identities = 60/245 (24%), Positives = 95/245 (38%), Gaps = 49/245 (20%)

Query: 41  VVYKGK-LENQRRIAVKRFNRMAWPDPRQ-FLEEARSVGQLRNNRLTNLLGCCCEGDERL 98
            VY  +  +  +++A+K   +       +  L E   + +L +  +  L G   + +   
Sbjct: 8   TVYLARDKKTGKKVAIKIIKKEDSSSLLEELLREIEILKKLNHPNIVKLYGVFEDENHLY 67

Query: 99  LVAEYMPNETLAKHLFHWETHPMKWAMRLRVVLHLAQALEYCTSKGRALYH-DLNAYRIL 157
           LV EY    +L   L   E   +     LR++L + + LEY  S G  + H DL    IL
Sbjct: 68  LVMEYCEGGSLKDLLKENE-GKLSEDEILRILLQILEGLEYLHSNG--IIHRDLKPENIL 124

Query: 158 FDED-GNPRLSTFGLMKNSRDGKSYST----NLAFTPPEYLR-TGRVTPESVIYSFGTLL 211
            D D G  +L+ FGL K     KS         A+  PE L   G  + +S I+S G +L
Sbjct: 125 LDSDNGKVKLADFGLSKLLTSDKSLLKTIVGTPAYMAPEVLLGKGYYSEKSDIWSLGVIL 184

Query: 212 LDLLSGKHIPPSHALDLIRDRNLQMLTDSCLEGQFTDDDGTELVRLASRCLQYEPRERPN 271
            +L            DLIR                             + LQ +P +RP+
Sbjct: 185 YEL--------PELKDLIR-----------------------------KMLQKDPEKRPS 207

Query: 272 PKSLV 276
            K ++
Sbjct: 208 AKEIL 212


Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which one kinase activates a second kinase, which in turn, may act on other kinases; this sequential action transmits a signal from the cell surface to target proteins, which results in cellular responses. The PK family is one of the largest known protein families with more than 100 homologous yeast enzymes and 550 human proteins. A fraction of PK family members are pseudokinases that lack crucial residues for catalytic activity. The mutiplicity of kinases allows for specific regulation according to substrate, tissue distribution, and cellular localization. PKs regulate many cellular processes including proliferation, division, differentiation, motility, survival, metabolism, cell-cycle progression, cytoskeletal rearrangement, immunity, and neuronal functions. Many kinases are implicated in the development of various human diseases including different types of cancer. Length = 215

>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|133207 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173643 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 460
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG1187361 consensus Serine/threonine protein kinase [Signal 100.0
KOG0595429 consensus Serine/threonine-protein kinase involved 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0197468 consensus Tyrosine kinases [Signal transduction me 100.0
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
KOG0600560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
KOG0582516 consensus Ste20-like serine/threonine protein kina 100.0
KOG0661538 consensus MAPK related serine/threonine protein ki 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
KOG0592604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0663419 consensus Protein kinase PITSLRE and related kinas 100.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 100.0
KOG4721 904 consensus Serine/threonine protein kinase, contain 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0605550 consensus NDR and related serine/threonine kinases 100.0
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
KOG0201467 consensus Serine/threonine protein kinase [Signal 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
PHA02988283 hypothetical protein; Provisional 100.0
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 100.0
KOG0589426 consensus Serine/threonine protein kinase [General 100.0
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0660359 consensus Mitogen-activated protein kinase [Signal 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
KOG1026774 consensus Nerve growth factor receptor TRKA and re 100.0
KOG0585576 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 100.0
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 100.0
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 100.0
KOG0611 668 consensus Predicted serine/threonine protein kinas 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 100.0
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 100.0
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 100.0
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 100.0
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 100.0
PLN00034353 mitogen-activated protein kinase kinase; Provision 100.0
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 100.0
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
PTZ00267478 NIMA-related protein kinase; Provisional 100.0
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
KOG0694694 consensus Serine/threonine protein kinase [Signal 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 100.0
KOG0577 948 consensus Serine/threonine protein kinase [Signal 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 100.0
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 100.0
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 100.0
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 100.0
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 100.0
KOG1989 738 consensus ARK protein kinase family [Signal transd 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 100.0
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 100.0
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 100.0
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 100.0
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 100.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 100.0
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 100.0
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 100.0
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 100.0
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 100.0
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 100.0
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 100.0
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 100.0
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 100.0
PTZ00283496 serine/threonine protein kinase; Provisional 100.0
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 100.0
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 100.0
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 100.0
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 100.0
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 100.0
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 100.0
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 100.0
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 100.0
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 100.0
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 100.0
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 100.0
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 100.0
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 100.0
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 100.0
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 100.0
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 100.0
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 100.0
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 100.0
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 100.0
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 100.0
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 100.0
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 100.0
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 100.0
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 100.0
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 100.0
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 100.0
KOG0610459 consensus Putative serine/threonine protein kinase 100.0
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 100.0
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 100.0
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 100.0
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 100.0
KOG0574502 consensus STE20-like serine/threonine kinase MST [ 100.0
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 100.0
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 100.0
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 100.0
KOG4717 864 consensus Serine/threonine protein kinase [Signal 100.0
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 100.0
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 100.0
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 100.0
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 100.0
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 100.0
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 100.0
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 100.0
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 100.0
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 100.0
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 100.0
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 100.0
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 100.0
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 100.0
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 100.0
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 100.0
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 100.0
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 100.0
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 100.0
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 100.0
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 100.0
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 100.0
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 100.0
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 100.0
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 100.0
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 100.0
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 100.0
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 100.0
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 100.0
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 100.0
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 100.0
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 100.0
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 100.0
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 100.0
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 100.0
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 100.0
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 100.0
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 100.0
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 100.0
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 100.0
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 100.0
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 100.0
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 100.0
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 100.0
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 100.0
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 100.0
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 100.0
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 100.0
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 100.0
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 100.0
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 100.0
PTZ00266 1021 NIMA-related protein kinase; Provisional 100.0
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 100.0
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 100.0
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 100.0
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 100.0
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 100.0
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 100.0
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 100.0
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 100.0
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 100.0
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 100.0
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 100.0
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 100.0
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 100.0
PHA03211461 serine/threonine kinase US3; Provisional 100.0
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 100.0
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 100.0
KOG0596677 consensus Dual specificity; serine/threonine and t 100.0
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 100.0
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 100.0
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 100.0
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 100.0
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 100.0
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 100.0
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 100.0
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 100.0
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 100.0
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 100.0
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 100.0
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 100.0
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 100.0
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 100.0
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 100.0
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 100.0
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 100.0
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 100.0
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 100.0
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 100.0
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 100.0
PHA03207392 serine/threonine kinase US3; Provisional 100.0
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 100.0
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 100.0
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 100.0
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 100.0
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 100.0
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 100.0
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 100.0
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 100.0
KOG0586 596 consensus Serine/threonine protein kinase [General 100.0
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 100.0
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 100.0
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 100.0
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 100.0
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 100.0
PHA03209357 serine/threonine kinase US3; Provisional 100.0
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 100.0
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 100.0
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 100.0
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 100.0
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 100.0
PTZ00284467 protein kinase; Provisional 100.0
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 100.0
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 100.0
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 100.0
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 100.0
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 100.0
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 100.0
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 100.0
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 100.0
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 100.0
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 100.0
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 100.0
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 100.0
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 100.0
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 100.0
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 100.0
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 100.0
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 100.0
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 100.0
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 100.0
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 100.0
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 100.0
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 100.0
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 100.0
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 100.0
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 100.0
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 100.0
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 100.0
PLN00009294 cyclin-dependent kinase A; Provisional 100.0
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 100.0
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 100.0
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 100.0
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 100.0
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 100.0
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 100.0
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 100.0
PHA02882294 putative serine/threonine kinase; Provisional 100.0
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 100.0
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 100.0
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 100.0
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 100.0
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 100.0
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 100.0
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 100.0
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 100.0
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 100.0
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 100.0
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 100.0
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 100.0
PHA03210501 serine/threonine kinase US3; Provisional 100.0
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 100.0
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 100.0
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 100.0
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 100.0
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 100.0
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 100.0
KOG0607463 consensus MAP kinase-interacting kinase and relate 100.0
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 100.0
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 100.0
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 100.0
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 100.0
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 100.0
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 100.0
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 100.0
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 100.0
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 100.0
KOG0584 632 consensus Serine/threonine protein kinase [General 100.0
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 100.0
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 100.0
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 100.0
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 100.0
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 100.0
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 100.0
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 100.0
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 100.0
KOG0986591 consensus G protein-coupled receptor kinase [Signa 100.0
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 100.0
KOG0690516 consensus Serine/threonine protein kinase [Signal 100.0
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 100.0
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 100.0
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 100.0
PTZ00024335 cyclin-dependent protein kinase; Provisional 100.0
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 100.0
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 100.0
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 100.0
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 100.0
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 100.0
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 100.0
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 100.0
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 100.0
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 100.0
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 100.0
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 100.0
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 100.0
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 100.0
KOG10251177 consensus Epidermal growth factor receptor EGFR an 100.0
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 100.0
KOG3653534 consensus Transforming growth factor beta/activin 100.0
KOG0696683 consensus Serine/threonine protein kinase [Signal 100.0
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 100.0
KOG0200609 consensus Fibroblast/platelet-derived growth facto 100.0
KOG1151775 consensus Tousled-like protein kinase [Signal tran 100.0
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 100.0
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 100.0
KOG0671415 consensus LAMMER dual specificity kinases [Signal 100.0
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 100.0
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 100.0
KOG2052513 consensus Activin A type IB receptor, serine/threo 100.0
PLN03224507 probable serine/threonine protein kinase; Provisio 100.0
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 100.0
KOG06081034 consensus Warts/lats-like serine threonine kinases 100.0
KOG0576 829 consensus Mitogen-activated protein kinase kinase 100.0
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.98
KOG1027903 consensus Serine/threonine protein kinase and endo 99.98
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.97
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.97
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.97
KOG1152772 consensus Signal transduction serine/threonine kin 99.97
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.97
KOG1290590 consensus Serine/threonine protein kinase [Signal 99.96
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.96
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.96
KOG1167418 consensus Serine/threonine protein kinase of the C 99.96
KOG1165449 consensus Casein kinase (serine/threonine/tyrosine 99.95
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.95
PLN00181 793 protein SPA1-RELATED; Provisional 99.95
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.95
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.94
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.94
PRK09188365 serine/threonine protein kinase; Provisional 99.93
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.91
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.91
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.91
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.9
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.89
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.87
PRK12274218 serine/threonine protein kinase; Provisional 99.87
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.86
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.86
PRK10345210 hypothetical protein; Provisional 99.85
KOG0553 304 consensus TPR repeat-containing protein [General f 99.85
KOG1023484 consensus Natriuretic peptide receptor, guanylate 99.83
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.83
smart00090237 RIO RIO-like kinase. 99.82
PRK14879211 serine/threonine protein kinase; Provisional 99.81
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.79
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.79
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.78
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.77
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.76
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.76
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.73
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.72
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.72
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.7
PRK15359144 type III secretion system chaperone protein SscB; 99.69
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.66
KOG4234271 consensus TPR repeat-containing protein [General f 99.64
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 99.63
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.6
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.6
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.59
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.59
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.57
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.57
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.56
KOG1125579 consensus TPR repeat-containing protein [General f 99.55
PRK11189 296 lipoprotein NlpI; Provisional 99.55
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.52
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.5
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.49
KOG1243 690 consensus Protein kinase [General function predict 99.49
PRK10370198 formate-dependent nitrite reductase complex subuni 99.49
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.48
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 99.48
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 99.46
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.44
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.42
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.4
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.38
KOG1266458 consensus Protein kinase [Signal transduction mech 99.38
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 99.38
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 99.37
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.37
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.35
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.34
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 99.34
KOG4555175 consensus TPR repeat-containing protein [Function 99.33
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 99.33
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.32
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.31
PLN02789 320 farnesyltranstransferase 99.31
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.3
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.3
KOG1126 638 consensus DNA-binding cell division cycle control 99.29
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.29
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.29
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 99.28
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.27
KOG3087229 consensus Serine/threonine protein kinase [General 99.27
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.27
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.24
KOG3741655 consensus Poly(A) ribonuclease subunit [RNA proces 99.24
PRK12370 553 invasion protein regulator; Provisional 99.23
KOG06061205 consensus Microtubule-associated serine/threonine 99.22
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 99.21
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 99.2
PRK15359144 type III secretion system chaperone protein SscB; 99.2
PRK15331165 chaperone protein SicA; Provisional 99.18
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.17
PRK12370553 invasion protein regulator; Provisional 99.16
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.16
KOG1126638 consensus DNA-binding cell division cycle control 99.16
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.15
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 99.15
PRK10370198 formate-dependent nitrite reductase complex subuni 99.15
PRK10803263 tol-pal system protein YbgF; Provisional 99.14
COG4248 637 Uncharacterized protein with protein kinase and he 99.13
COG3063 250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.13
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.12
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=1.5e-53  Score=383.61  Aligned_cols=244  Identities=19%  Similarity=0.273  Sum_probs=210.5

Q ss_pred             cccchhcccCCCCCCeEEEEEE-cCCcEEEEEEecCCCCCC-HHHHHHHHHHHhcCCCCccceeeeEEeeCCe-eEEEEE
Q 012608           26 AVENIVSEHGEKAPNVVYKGKL-ENQRRIAVKRFNRMAWPD-PRQFLEEARSVGQLRNNRLTNLLGCCCEGDE-RLLVAE  102 (460)
Q Consensus        26 ~~~~i~~~lg~G~~g~Vy~~~~-~~~~~vavK~~~~~~~~~-~~~~~~E~~~l~~l~h~~iv~~~~~~~~~~~-~~lv~e  102 (460)
                      ++.+.++.||+|+.|+||++.+ .+++.+|+|++....... .+++.+|+++++.++||+||.+||.|..++. +.|+||
T Consensus        79 ~dle~~~~lG~G~gG~V~kv~Hk~t~~i~AlK~I~~~~~~~~~~Qi~rEl~il~~~~spyIV~~ygaF~~~~~~isI~mE  158 (364)
T KOG0581|consen   79 SDLERLGVLGSGNGGTVYKVRHKPTGKIYALKVILLNIDPALQKQILRELEILRSCQSPYIVGFYGAFYSNGEEISICME  158 (364)
T ss_pred             HHhhhhhhcccCCCcEEEEEEEcCCCeEEEEEeecccCCHHHHHHHHHHHHHHhhCCCCCeeeEeEEEEeCCceEEeehh
Confidence            4667789999999999999995 468999999996554333 6789999999999999999999999999984 999999


Q ss_pred             cCCCCCHHhhhhccCCCCCCHHHHHHHHHHHHHHHHHHHh-CCCcccccccCCcEEEcCCCCeEEccCCCcccCCCC--C
Q 012608          103 YMPNETLAKHLFHWETHPMKWAMRLRVVLHLAQALEYCTS-KGRALYHDLNAYRILFDEDGNPRLSTFGLMKNSRDG--K  179 (460)
Q Consensus       103 ~~~g~sL~~~~~~~~~~~~~~~~~~~i~~qi~~~l~~lH~-~~~iiH~Dikp~Nill~~~~~~kl~DFg~a~~~~~~--~  179 (460)
                      ||+||||++++..  .+.+++...-+|+.+|++||.|||. .+ ||||||||+|||++..|.+||||||.++.....  .
T Consensus       159 YMDgGSLd~~~k~--~g~i~E~~L~~ia~~VL~GL~YLh~~~~-IIHRDIKPsNlLvNskGeVKicDFGVS~~lvnS~a~  235 (364)
T KOG0581|consen  159 YMDGGSLDDILKR--VGRIPEPVLGKIARAVLRGLSYLHEERK-IIHRDIKPSNLLVNSKGEVKICDFGVSGILVNSIAN  235 (364)
T ss_pred             hcCCCCHHHHHhh--cCCCCHHHHHHHHHHHHHHHHHHhhccC-eeeccCCHHHeeeccCCCEEeccccccHHhhhhhcc
Confidence            9999999999863  4779999999999999999999996 66 999999999999999999999999998866543  6


Q ss_pred             CccCCCcccCccccccCCCCCCCceehHHHHHHHHhhCCCCCCCh-----hhhhhhhccccccccccccCCCCch-hHHH
Q 012608          180 SYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSH-----ALDLIRDRNLQMLTDSCLEGQFTDD-DGTE  253 (460)
Q Consensus       180 ~~~~t~~y~aPE~~~~~~~~~~sDi~slG~~l~el~tg~~p~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~  253 (460)
                      ++.||..|||||.+.+..|+.++||||||++++|+++|+.|++..     ..-.+....    .+ .+++.+|.. ++++
T Consensus       236 tfvGT~~YMsPERi~g~~Ys~~sDIWSLGLsllE~a~GrfP~~~~~~~~~~~~~Ll~~I----v~-~ppP~lP~~~fS~e  310 (364)
T KOG0581|consen  236 TFVGTSAYMSPERISGESYSVKSDIWSLGLSLLELAIGRFPYPPPNPPYLDIFELLCAI----VD-EPPPRLPEGEFSPE  310 (364)
T ss_pred             cccccccccChhhhcCCcCCcccceecccHHHHHHhhCCCCCCCcCCCCCCHHHHHHHH----hc-CCCCCCCcccCCHH
Confidence            889999999999999999999999999999999999999888764     111111111    11 122345554 8899


Q ss_pred             HHHHHHHHcccCCCCCCChhHHHH
Q 012608          254 LVRLASRCLQYEPRERPNPKSLVT  277 (460)
Q Consensus       254 l~~li~~~l~~~p~~Rps~~~il~  277 (460)
                      ++.|+..||++||.+|||+.++++
T Consensus       311 f~~FV~~CL~Kdp~~R~s~~qLl~  334 (364)
T KOG0581|consen  311 FRSFVSCCLRKDPSERPSAKQLLQ  334 (364)
T ss_pred             HHHHHHHHhcCCcccCCCHHHHhc
Confidence            999999999999999999999997



>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query460
3uim_A326 Structural Basis For The Impact Of Phosphorylation 3e-24
3tl8_A349 The Avrptob-Bak1 Complex Reveals Two Structurally S 3e-24
2nry_A307 Crystal Structure Of Irak-4 Length = 307 8e-23
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 9e-23
2nru_A307 Crystal Structure Of Irak-4 Length = 307 1e-22
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 1e-20
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 1e-19
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 5e-19
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 1e-13
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 2e-13
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 2e-13
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 2e-13
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 2e-13
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 2e-13
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 2e-13
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 2e-12
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 3e-12
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 3e-12
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 1e-11
1byg_A278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 1e-11
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 2e-11
3d7u_A263 Structural Basis For The Recognition Of C-Src By It 2e-11
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 2e-11
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 3e-11
2zm3_A308 Complex Structure Of Insulin-Like Growth Factor Rec 3e-11
3i81_A315 Crystal Structure Of Insulin-Like Growth Factor 1 R 5e-11
1jqh_A308 Igf-1 Receptor Kinase Domain Length = 308 6e-11
3o23_A305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 6e-11
2oj9_A307 Structure Of Igf-1r Kinase Domain Complexed With A 6e-11
3qqu_A301 Cocrystal Structure Of Unphosphorylated Igf With Py 7e-11
1m7n_A322 Crystal Structure Of Unactivated Apo Insulin-Like G 7e-11
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 9e-11
3lvp_A336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 1e-10
1k3a_A299 Structure Of The Insulin-Like Growth Factor 1 Recep 1e-10
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 1e-10
3lw0_A304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 1e-10
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 1e-10
2pl0_A289 Lck Bound To Imatinib Length = 289 1e-10
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 1e-10
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 2e-10
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 2e-10
1p4o_A322 Structure Of Apo Unactivated Igf-1r Kinase Domain A 2e-10
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 2e-10
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 2e-10
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 3e-10
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 3e-10
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 3e-10
4h58_A275 Braf In Complex With Compound 3 Length = 275 3e-10
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 3e-10
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 3e-10
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 3e-10
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 3e-10
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 3e-10
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 3e-10
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 3e-10
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 4e-10
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 4e-10
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 4e-10
2z8c_A303 Phosphorylated Insulin Receptor Tyrosine Kinase In 4e-10
1ir3_A306 Phosphorylated Insulin Receptor Tyrosine Kinase In 4e-10
3d94_A301 Crystal Structure Of The Insulin-Like Growth Factor 5e-10
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 6e-10
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 6e-10
1irk_A306 Crystal Structure Of The Tyrosine Kinase Domain Of 7e-10
3eta_A317 Kinase Domain Of Insulin Receptor Complexed With A 7e-10
1i44_A306 Crystallographic Studies Of An Activation Loop Muta 7e-10
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 8e-10
1rqq_A306 Crystal Structure Of The Insulin Receptor Kinase In 9e-10
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 9e-10
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 1e-09
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 1e-09
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 1e-09
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 1e-09
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 1e-09
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 1e-09
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 1e-09
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 1e-09
4fvp_A289 Crystal Structure Of The Jak2 Pseudokinase Domain ( 1e-09
2g15_A318 Structural Characterization Of Autoinhibited C-Met 2e-09
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 2e-09
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 2e-09
2dq7_X283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 2e-09
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 2e-09
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 2e-09
3q6u_A308 Structure Of The Apo Met Receptor Kinase In The Dua 2e-09
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 2e-09
3lq8_A302 Structure Of The Kinase Domain Of C-Met Bound To Xl 2e-09
2wgj_A306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 2e-09
4fvr_A289 Crystal Structure Of The Jak2 Pseudokinase Domain M 2e-09
3f66_A298 Human C-Met Kinase In Complex With Quinoxaline Inhi 2e-09
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 2e-09
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 2e-09
2rfn_A310 X-ray Structure Of C-met With Inhibitor. Length = 3 2e-09
4gg5_A319 Crystal Structure Of Cmet In Complex With Novel Inh 2e-09
3i5n_A309 Crystal Structure Of C-Met With Triazolopyridazine 2e-09
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 2e-09
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 2e-09
2wd1_A292 Human C-Met Kinase In Complex With Azaindole Inhibi 2e-09
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 2e-09
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 3e-09
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 3e-09
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 3e-09
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 3e-09
1yoj_A283 Crystal Structure Of Src Kinase Domain Length = 283 4e-09
1yol_A283 Crystal Structure Of Src Kinase Domain In Complex W 4e-09
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 5e-09
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 5e-09
3svv_A286 Crystal Structure Of T338c C-Src Covalently Bound T 5e-09
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 5e-09
2oiq_A286 Crystal Structure Of Chicken C-Src Kinase Domain In 5e-09
3ekk_A307 Insulin Receptor Kinase Complexed With An Inhibitor 6e-09
3dqw_A286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 6e-09
3d7u_B277 Structural Basis For The Recognition Of C-Src By It 6e-09
3geq_A286 Structural Basis For The Chemical Rescue Of Src Kin 6e-09
1p14_A306 Crystal Structure Of A Catalytic-Loop Mutant Of The 6e-09
3g6h_A286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 6e-09
3u4w_A275 Src In Complex With Dna-Templated Macrocyclic Inhib 7e-09
3oez_A286 Crystal Structure Of The L317i Mutant Of The Chicke 8e-09
2hwo_A286 Crystal Structure Of Src Kinase Domain In Complex W 8e-09
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 9e-09
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 9e-09
2qq7_A286 Crystal Structure Of Drug Resistant Src Kinase Doma 1e-08
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 1e-08
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 1e-08
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 1e-08
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 1e-08
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 1e-08
3q6w_A307 Structure Of Dually-phosphorylated Met Receptor Kin 1e-08
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 1e-08
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 2e-08
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 2e-08
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 2e-08
3a4o_X286 Lyn Kinase Domain Length = 286 2e-08
4asz_A299 Crystal Structure Of Apo Trkb Kinase Domain Length 2e-08
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 2e-08
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 3e-08
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 3e-08
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 4e-08
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 5e-08
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 5e-08
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 5e-08
3nyx_A302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 6e-08
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 6e-08
3c1x_A373 Crystal Structure Of The Tyrosine Kinase Domain Of 7e-08
3cth_A314 Crystal Structure Of The Tyrosine Kinase Domain Of 9e-08
3qti_A314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 9e-08
1luf_A343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 9e-08
3dkc_A317 Sgx Clone 5698a65kfg1h1 Length = 317 1e-07
3dkg_A317 Sgx Clone 5698a109kfg1h1 Length = 317 1e-07
3a4p_A319 Human C-Met Kinase Domain Complexed With 6-Benzylox 1e-07
1r0p_A312 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-07
3nz0_A302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 1e-07
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 1e-07
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-07
4bbe_A298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 2e-07
2ivs_A314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 2e-07
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 2e-07
3lxn_A318 Structural And Thermodynamic Characterization Of Th 2e-07
4f1o_A287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 3e-07
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 4e-07
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 4e-07
4f1m_A287 Crystal Structure Of The G1179s Roco4 Kinase Domain 4e-07
3b2t_A311 Structure Of Phosphotransferase Length = 311 4e-07
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 4e-07
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 4e-07
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 5e-07
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 5e-07
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 5e-07
2pzp_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-07
2pvy_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-07
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 5e-07
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 5e-07
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 5e-07
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 5e-07
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 5e-07
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 6e-07
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 6e-07
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 6e-07
3pls_A298 Ron In Complex With Ligand Amp-Pnp Length = 298 6e-07
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 6e-07
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 6e-07
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 6e-07
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 7e-07
3gqi_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 8e-07
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 8e-07
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 8e-07
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 9e-07
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 9e-07
2psq_A370 Crystal Structure Of Unphosphorylated Unactivated W 9e-07
3dzq_A361 Human Epha3 Kinase Domain In Complex With Inhibitor 9e-07
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 1e-06
2qok_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-06
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 1e-06
3fxx_A371 Human Epha3 Kinase And Juxtamembrane Region Bound T 1e-06
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 1e-06
2qof_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 1e-06
2qod_A373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 1e-06
2gsf_A373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 1e-06
2qoi_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-06
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 1e-06
2qoo_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-06
2qol_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 1e-06
4f63_A309 Crystal Structure Of Human Fibroblast Growth Factor 2e-06
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 2e-06
3js2_A317 Crystal Structure Of Minimal Kinase Domain Of Fibro 2e-06
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 2e-06
1fgk_A310 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-06
3tt0_A382 Co-Structure Of Fibroblast Growth Factor Receptor 1 2e-06
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 2e-06
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 2e-06
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 2e-06
3rhx_B306 Crystal Structure Of The Catalytic Domain Of Fgfr1 2e-06
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 2e-06
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 2e-06
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 2e-06
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 2e-06
2pwl_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-06
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 2e-06
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 2e-06
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 2e-06
2ivt_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 2e-06
2q0b_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-06
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 2e-06
2qon_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-06
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 2e-06
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 2e-06
4e1z_A291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 2e-06
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 3e-06
4e20_A290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 3e-06
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 3e-06
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 3e-06
2pz5_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 3e-06
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 3e-06
2py3_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 3e-06
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 3e-06
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 3e-06
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 3e-06
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 3e-06
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 3e-06
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 4e-06
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 4e-06
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 4e-06
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 4e-06
4fie_A423 Full-Length Human Pak4 Length = 423 4e-06
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 4e-06
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 4e-06
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 4e-06
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 4e-06
2rei_A318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 4e-06
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 4e-06
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 4e-06
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 4e-06
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 5e-06
2yjr_A342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 5e-06
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 5e-06
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 5e-06
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 5e-06
2ivv_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 5e-06
4fnw_A327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 6e-06
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 6e-06
3g51_A325 Structural Diversity Of The Active Conformation Of 6e-06
1mqb_A333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 6e-06
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 8e-06
2qob_A344 Human Epha3 Kinase Domain, Base Structure Length = 8e-06
2yfx_A327 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 9e-06
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 9e-06
3cc6_A281 Crystal Structure Of Kinase Domain Of Protein Tyros 9e-06
2yhv_A342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 1e-05
4h1j_A293 Crystal Structure Of Pyk2 With The Pyrazole 13a Len 1e-05
3aox_A344 X-Ray Crystal Structure Of Human Anaplastic Lymphom 1e-05
3l9p_A367 Crystal Structure Of The Anaplastic Lymphoma Kinase 1e-05
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 1e-05
3lct_A344 Crystal Structure Of The Anaplastic Lymphoma Kinase 1e-05
2xp2_A327 Structure Of The Human Anaplastic Lymphoma Kinase I 1e-05
3fzo_A277 Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin 1e-05
2xb7_A315 Structure Of Human Anaplastic Lymphoma Kinase In Co 1e-05
4fnz_A327 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-05
2qo7_A373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 1e-05
3bea_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 1e-05
2yjs_A342 Structure Of C1156y Mutant Anaplastic Lymphoma Kina 1e-05
4dce_A333 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-05
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 1e-05
4fob_A353 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-05
2ogv_A317 Crystal Structure Of The Autoinhibited Human C-Fms 1e-05
4aoj_A329 Human Trka In Complex With The Inhibitor Az-23 Leng 1e-05
4f0i_A300 Crystal Structure Of Apo Trka Length = 300 1e-05
3zgw_A347 Crystal Structure Of Maternal Embryonic Leucine Zip 1e-05
4gt5_A306 Crystal Structure Of The Inactive Trka Kinase Domai 1e-05
3lcd_A329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 2e-05
2r2p_A295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 3e-05
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 3e-05
2i1m_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 3e-05
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 3e-05
4fnx_A327 Crystal Structure Of The Apo R1275q Anaplastic Lymp 3e-05
3a7f_A303 Human Mst3 Kinase Length = 303 3e-05
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 3e-05
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 3e-05
2f2u_A402 Crystal Structure Of The Rho-Kinase Kinase Domain L 3e-05
2hel_A306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 3e-05
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 4e-05
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 4e-05
2etm_A281 Crystal Structure Of Focal Adhesion Kinase Domain C 4e-05
3txo_A353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 4e-05
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 4e-05
3bz3_A276 Crystal Structure Analysis Of Focal Adhesion Kinase 5e-05
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 5e-05
3pxk_A282 Focal Adhesion Kinase Catalytic Domain In Complex W 5e-05
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 5e-05
2i0v_A335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 6e-05
3bbt_B328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 6e-05
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 7e-05
1jpa_A312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 7e-05
2r4b_A321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 7e-05
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 9e-05
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 1e-04
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 1e-04
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 1e-04
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 1e-04
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 1e-04
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 1e-04
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 1e-04
4gt4_A308 Structure Of Unliganded, Inactive Ror2 Kinase Domai 1e-04
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 1e-04
3g2f_A336 Crystal Structure Of The Kinase Domain Of Bone Morp 1e-04
3zzw_A289 Crystal Structure Of The Kinase Domain Of Ror2 Leng 2e-04
3cjf_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 2e-04
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-04
3lco_A324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 2e-04
2i0e_A353 Structure Of Catalytic Domain Of Human Protein Kina 2e-04
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 2e-04
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 2e-04
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 2e-04
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 3e-04
2y6m_A291 Crystal Structure Of Epha4 Kinase Domain Length = 2 3e-04
3s95_A310 Crystal Structure Of The Human Limk1 Kinase Domain 3e-04
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 3e-04
2xyu_A285 Crystal Structure Of Epha4 Kinase Domain In Complex 3e-04
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 3e-04
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 3e-04
1elw_A118 Crystal Structure Of The Tpr1 Domain Of Hop In Comp 4e-04
3nyn_A576 Crystal Structure Of G Protein-Coupled Receptor Kin 4e-04
2acx_A576 Crystal Structure Of G Protein Coupled Receptor Kin 5e-04
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 5e-04
3cjg_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 6e-04
1fvr_A327 Tie2 Kinase Domain Length = 327 6e-04
2hen_A286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 6e-04
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 6e-04
2oo8_X317 Synthesis, Structural Analysis, And Sar Studies Of 6e-04
4agc_A353 Crystal Structure Of Vegfr2 (Juxtamembrane And Kina 6e-04
2xir_A316 Crystal Structure Of The Vegfr2 Kinase Domain In Co 7e-04
3hng_A360 Crystal Structure Of Vegfr1 In Complex With N-(4-ch 7e-04
3ewh_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 7e-04
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 7e-04
3u6j_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 7e-04
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 7e-04
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 7e-04
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 8e-04
2p0c_A313 Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro 8e-04
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure

Iteration: 1

Score = 109 bits (273), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 84/298 (28%), Positives = 135/298 (45%), Gaps = 30/298 (10%) Query: 7 LPSFREFTLEQLKNATSGFAVENIVSEHGEKAPNVVYKGKLENQRRIAVKRFNR-MAWPD 65 L + F+L +L+ A+ F +NI+ G VYKG+L + +AVKR Sbjct: 14 LGQLKRFSLRELQVASDNFXNKNIL---GRGGFGKVYKGRLADGXLVAVKRLKEERTQGG 70 Query: 66 PRQFLEEARSVGQLRNNRLTNLLGCCCEGDERLLVAEYMPNETLAKHLFHWETH--PMKW 123 QF E + + L L G C ERLLV YM N ++A L P+ W Sbjct: 71 ELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPESQPPLDW 130 Query: 124 AMRLRVVLHLAQALEY----CTSKGRALYHDLNAYRILFDEDGNPRLSTFGL-----MKN 174 R R+ L A+ L Y C K ++ D+ A IL DE+ + FGL K+ Sbjct: 131 PKRQRIALGSARGLAYLHDHCDPK--IIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKD 188 Query: 175 SRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHAL-------- 226 + + PEYL TG+ + ++ ++ +G +LL+L++G+ L Sbjct: 189 XHVXXAVRGXIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVML 248 Query: 227 -----DLIRDRNLQMLTDSCLEGQFTDDDGTELVRLASRCLQYEPRERPNPKSLVTAL 279 L++++ L+ L D L+G + D++ +L+++A C Q P ERP +V L Sbjct: 249 LDWVKGLLKEKKLEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRML 306
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 Back     alignment and structure
>pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|2Z8C|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin-2- Yl]amino}phenyl)acetic Acid Length = 303 Back     alignment and structure
>pdb|1IR3|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With Peptide Substrate And Atp Analog Length = 306 Back     alignment and structure
>pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|1IRK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Human Insulin Receptor Length = 306 Back     alignment and structure
>pdb|3ETA|A Chain A, Kinase Domain Of Insulin Receptor Complexed With A Pyrrolo Pyridine Inhibitor Length = 317 Back     alignment and structure
>pdb|1I44|A Chain A, Crystallographic Studies Of An Activation Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|1RQQ|A Chain A, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 306 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|4FVP|A Chain A, Crystal Structure Of The Jak2 Pseudokinase Domain (Apo Form) Length = 289 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|4FVR|A Chain A, Crystal Structure Of The Jak2 Pseudokinase Domain Mutant V617f (Mg- Atp-Bound Form) Length = 289 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|3EKK|A Chain A, Insulin Receptor Kinase Complexed With An Inhibitor Length = 307 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|1P14|A Chain A, Crystal Structure Of A Catalytic-Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|3PLS|A Chain A, Ron In Complex With Ligand Amp-Pnp Length = 298 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 Back     alignment and structure
>pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 Back     alignment and structure
>pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 Back     alignment and structure
>pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 Back     alignment and structure
>pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 Back     alignment and structure
>pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 Back     alignment and structure
>pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|3G2F|A Chain A, Crystal Structure Of The Kinase Domain Of Bone Morphogenetic Protein Receptor Type Ii (Bmpr2) At 2.35 A Resolution Length = 336 Back     alignment and structure
>pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 Back     alignment and structure
>pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 Back     alignment and structure
>pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 Back     alignment and structure
>pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 Back     alignment and structure
>pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query460
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 2e-61
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 8e-61
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 2e-58
3soc_A322 Activin receptor type-2A; structural genomics cons 1e-26
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 6e-25
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 1e-24
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 1e-23
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-21
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 3e-21
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 3e-21
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 5e-21
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 1e-20
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 2e-20
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 3e-20
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 2e-18
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 3e-18
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 4e-18
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 5e-18
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 1e-17
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 1e-17
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 1e-17
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 2e-17
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 2e-17
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 3e-17
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 5e-16
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 5e-16
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 7e-16
3pls_A298 Macrophage-stimulating protein receptor; protein k 1e-15
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 3e-15
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 4e-15
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 6e-15
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 1e-14
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 1e-14
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-14
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 4e-14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 5e-14
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 5e-14
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 5e-14
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 7e-14
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 7e-14
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 1e-13
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 1e-13
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 2e-13
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 2e-13
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 4e-13
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 4e-13
3lzb_A327 Epidermal growth factor receptor; epidermal growth 5e-13
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 6e-13
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 7e-13
3q4u_A301 Activin receptor type-1; structural genomics conso 9e-13
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 9e-13
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 9e-13
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 1e-12
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 1e-12
3poz_A327 Epidermal growth factor receptor; kinase domain, a 1e-12
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-12
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 2e-12
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 2e-12
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 3e-12
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 3e-12
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 3e-12
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 4e-12
4aoj_A329 High affinity nerve growth factor receptor; transf 5e-12
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 5e-12
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 5e-12
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 6e-12
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 6e-12
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 6e-12
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 7e-12
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 1e-11
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 1e-11
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-11
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 2e-11
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 3e-11
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 3e-11
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 4e-11
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 9e-11
3uqc_A286 Probable conserved transmembrane protein; structur 2e-10
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 2e-10
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 4e-10
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 5e-10
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 5e-10
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 7e-10
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 7e-10
2l6j_A111 TPR repeat-containing protein associated with HSP; 7e-10
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 8e-10
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 3e-09
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 3e-09
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 4e-09
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 5e-09
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 5e-09
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 6e-09
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 7e-09
2xir_A316 Vascular endothelial growth factor receptor 2; ang 9e-09
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 3e-08
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 4e-08
2gw1_A 514 Mitochondrial precursor proteins import receptor; 5e-08
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 6e-08
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 6e-08
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 1e-07
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 1e-07
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-07
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 1e-07
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-07
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-07
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-06
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-04
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 3e-07
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 3e-07
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 3e-07
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 3e-07
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 4e-07
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 6e-07
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-07
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-05
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 8e-07
3ork_A311 Serine/threonine protein kinase; structural genomi 1e-06
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 1e-06
2a19_B284 Interferon-induced, double-stranded RNA-activated 1e-06
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 2e-06
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 2e-06
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 4e-06
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 5e-06
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 5e-06
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-06
3pvu_A695 Beta-adrenergic receptor kinase 1; transferase, se 6e-06
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 8e-06
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 8e-06
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 8e-06
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 1e-05
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 1e-05
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 1e-05
3lij_A494 Calcium/calmodulin dependent protein kinase with A 1e-05
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 1e-05
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-05
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 1e-05
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 2e-05
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 2e-05
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 2e-05
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 2e-05
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 3e-05
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 3e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-04
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 4e-05
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 4e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 6e-05
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 6e-05
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 7e-05
2eue_A275 Carbon catabolite derepressing protein kinase; kin 7e-05
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 7e-05
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 8e-05
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 1e-04
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 1e-04
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 1e-04
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 1e-04
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 1e-04
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 1e-04
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 2e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-04
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 2e-04
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 3e-04
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 3e-04
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 4e-04
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 5e-04
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 6e-04
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 7e-04
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 7e-04
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
 Score =  201 bits (513), Expect = 2e-61
 Identities = 82/306 (26%), Positives = 138/306 (45%), Gaps = 40/306 (13%)

Query: 8   PSFREFTLEQLKNATSGFAVENIVSEH---GEKAPNVVYKGKLENQRRIAVKRFNRMAWP 64
             F  F+  +LKN T+ F    I       GE    VVYKG + N   +AVK+   M   
Sbjct: 10  TRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTT-VAVKKLAAMVDI 68

Query: 65  DP----RQFLEEARSVGQLRNNRLTNLLGCCCEGDERLLVAEYMPNETLAKHLFHWE-TH 119
                 +QF +E + + + ++  L  LLG   +GD+  LV  YMPN +L   L   + T 
Sbjct: 69  TTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTP 128

Query: 120 PMKWAMRLRVVLHLAQALEYCTSKGRALYHDLNAYR------ILFDEDGNPRLSTFGLMK 173
           P+ W MR ++    A  + +       L+ + + +R      IL DE    ++S FGL +
Sbjct: 129 PLSWHMRCKIAQGAANGINF-------LHENHHIHRDIKSANILLDEAFTAKISDFGLAR 181

Query: 174 -NSRDGKSY-STNLAFTP----PEYLRTGRVTPESVIYSFGTLLLDLLSGK-----HIPP 222
            + +  ++  ++ +  T     PE L  G +TP+S IYSFG +LL++++G      H  P
Sbjct: 182 ASEKFAQTVMTSRIVGTTAYMAPEAL-RGEITPKSDIYSFGVVLLEIITGLPAVDEHREP 240

Query: 223 SHALD-----LIRDRNLQMLTDSCLEGQFTDDDGTELVRLASRCLQYEPRERPNPKSLVT 277
              LD        ++ ++   D  +           +  +AS+CL  +  +RP+ K +  
Sbjct: 241 QLLLDIKEEIEDEEKTIEDYIDKKM-NDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQ 299

Query: 278 ALSPLQ 283
            L  + 
Sbjct: 300 LLQEMT 305


>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query460
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 100.0
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 100.0
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 100.0
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 100.0
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 100.0
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 100.0
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 100.0
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
3soc_A322 Activin receptor type-2A; structural genomics cons 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 100.0
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 100.0
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 100.0
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 100.0
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 100.0
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
3q4u_A301 Activin receptor type-1; structural genomics conso 100.0
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 100.0
2eue_A275 Carbon catabolite derepressing protein kinase; kin 100.0
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 100.0
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 100.0
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 100.0
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
3poz_A327 Epidermal growth factor receptor; kinase domain, a 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 100.0
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 100.0
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 100.0
3ork_A311 Serine/threonine protein kinase; structural genomi 100.0
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 100.0
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 100.0
3dls_A335 PAS domain-containing serine/threonine-protein KI; 100.0
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 100.0
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 100.0
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 100.0
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 100.0
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 100.0
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 100.0
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 100.0
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 100.0
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 100.0
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 100.0
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 100.0
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 100.0
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 100.0
3lzb_A327 Epidermal growth factor receptor; epidermal growth 100.0
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 100.0
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 100.0
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 100.0
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 100.0
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 100.0
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
2a19_B284 Interferon-induced, double-stranded RNA-activated 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
3pls_A298 Macrophage-stimulating protein receptor; protein k 100.0
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 100.0
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 100.0
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 100.0
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 100.0
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 100.0
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 100.0
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 100.0
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 100.0
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 100.0
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 100.0
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 100.0
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 100.0
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 100.0
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 100.0
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 100.0
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 100.0
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 100.0
3eqc_A360 Dual specificity mitogen-activated protein kinase; 100.0
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 100.0
3bhy_A283 Death-associated protein kinase 3; death associate 100.0
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 100.0
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 100.0
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
3lij_A494 Calcium/calmodulin dependent protein kinase with A 100.0
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 100.0
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 100.0
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 100.0
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 100.0
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 100.0
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 100.0
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 100.0
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 100.0
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 100.0
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 100.0
2fst_X367 Mitogen-activated protein kinase 14; active mutant 100.0
2xir_A316 Vascular endothelial growth factor receptor 2; ang 100.0
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 100.0
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 100.0
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 100.0
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 100.0
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 100.0
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 100.0
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 100.0
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 100.0
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 100.0
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 100.0
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 100.0
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 100.0
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 100.0
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 100.0
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 100.0
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 100.0
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 100.0
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 100.0
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 100.0
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 100.0
3fme_A290 Dual specificity mitogen-activated protein kinase; 100.0
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 100.0
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 100.0
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 100.0
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 100.0
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 100.0
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 100.0
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 100.0
3aln_A327 Dual specificity mitogen-activated protein kinase; 100.0
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 100.0
3an0_A340 Dual specificity mitogen-activated protein kinase; 100.0
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 100.0
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 100.0
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 100.0
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 100.0
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 100.0
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 100.0
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 100.0
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 100.0
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 100.0
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 100.0
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 100.0
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 100.0
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 100.0
3uqc_A286 Probable conserved transmembrane protein; structur 100.0
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 100.0
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 100.0
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 100.0
2dyl_A318 Dual specificity mitogen-activated protein kinase 100.0
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 100.0
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 100.0
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 100.0
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 100.0
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.98
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.95
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.92
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.86
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.86
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.83
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.79
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.77
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.76
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.76
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.75
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.74
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.73
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.73
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.71
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.7
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.66
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.65
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.64
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.64
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.64
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.63
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.62
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.62
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.62
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.62
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.61
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.61
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.6
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.6
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.59
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.59
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.59
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.59
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.59
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.59
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.58
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.57
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.57
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.56
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.55
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 99.55
3k9i_A117 BH0479 protein; putative protein binding protein, 99.54
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.53
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.52
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.52
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 99.51
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.51
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.51
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.49
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.49
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.48
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.48
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.43
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.43
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.43
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.43
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 99.41
1hh8_A 213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.41
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.4
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 99.4
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.39
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.38
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.38
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.38
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.37
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.36
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.36
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.36
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.36
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.36
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.35
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.35
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.35
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.34
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.34
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.33
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 99.33
3u4t_A272 TPR repeat-containing protein; structural genomics 99.33
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.32
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.32
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.32
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.32
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 99.32
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.32
3u4t_A 272 TPR repeat-containing protein; structural genomics 99.32
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 99.32
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.32
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.32
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.31
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.31
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.3
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.3
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.3
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.29
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.27
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.27
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 99.27
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.26
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.26
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.26
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.26
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.26
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.25
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.25
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.25
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.25
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.24
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.24
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.24
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.24
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.23
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.23
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.22
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 99.22
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.21
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.2
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.2
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.17
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.16
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 99.15
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.15
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.14
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.14
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.13
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 99.12
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.12
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.12
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.11
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.11
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 99.11
3k9i_A117 BH0479 protein; putative protein binding protein, 99.11
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.11
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.11
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.1
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.1
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.09
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.08
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.08
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.08
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.08
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.08
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.08
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.07
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.07
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.06
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.06
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 99.06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.06
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 99.05
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.05
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.03
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.03
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.03
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.03
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 99.03
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 99.02
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.02
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.02
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.02
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.01
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.01
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.01
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.01
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.01
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.0
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 98.99
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 98.98
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.98
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.97
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.97
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.97
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 98.97
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 98.96
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.96
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.96
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.94
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.92
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.91
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.89
3r70_A320 Aminoglycoside phosphotransferase; structural geno 98.88
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.87
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.86
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.85
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.85
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.84
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.84
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.83
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.81
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.8
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.8
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 98.79
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.79
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.76
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.73
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 98.73
3d1u_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 98.7
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 98.68
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.67
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.66
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.65
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.65
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.63
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.61
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.57
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.55
3ats_A357 Putative uncharacterized protein; hypothetical pro 98.55
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 98.53
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.49
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.47
2olc_A397 MTR kinase, methylthioribose kinase; kinase ADP-2H 98.47
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.41
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.4
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.39
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.36
2q83_A346 YTAA protein; 2635576, structural genomics, joint 98.35
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.34
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.29
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.25
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.2
3jr1_A312 Putative fructosamine-3-kinase; YP_719053.1, struc 98.18
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.15
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.14
1zyl_A328 Hypothetical protein YIHE; putative protein kinase 98.1
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 98.09
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.07
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.06
3f7w_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 98.05
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.01
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.0
2pyw_A420 Uncharacterized protein; 5-methylthioribose kinase 97.98
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.95
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.87
3feg_A379 Choline/ethanolamine kinase; non-protein kinase, c 97.85
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.84
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.8
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 97.77
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.76
3csv_A333 Aminoglycoside phosphotransferase; YP_614837.1, ph 97.74
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.71
3dxq_A301 Choline/ethanolamine kinase family protein; NP_106 97.63
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.58
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.57
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.56
3i1a_A339 Spectinomycin phosphotransferase; protein kinase, 97.54
1nw1_A429 Choline kinase (49.2 KD); phospholipid synthesis, 97.53
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.49
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.46
2qg7_A458 Ethanolamine kinase PV091845; malaria, SGC, struct 97.46
3c5i_A369 Choline kinase; choline, kinase, malaria, transfer 97.41
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
Probab=100.00  E-value=9.5e-59  Score=439.20  Aligned_cols=248  Identities=17%  Similarity=0.211  Sum_probs=210.7

Q ss_pred             CCcccchhcccCCCCCCeEEEEEE-cCCcEEEEEEecCCCCCC--HHHHHHHHHHHhcCCCCccceeeeEEeeCCeeEEE
Q 012608           24 GFAVENIVSEHGEKAPNVVYKGKL-ENQRRIAVKRFNRMAWPD--PRQFLEEARSVGQLRNNRLTNLLGCCCEGDERLLV  100 (460)
Q Consensus        24 ~f~~~~i~~~lg~G~~g~Vy~~~~-~~~~~vavK~~~~~~~~~--~~~~~~E~~~l~~l~h~~iv~~~~~~~~~~~~~lv  100 (460)
                      +.++|+++++||+|+||+||+|+. .+|+.||||+++......  .+.+.+|+.+|++|+|||||++++++..++.+|||
T Consensus        22 sme~Y~~~~~lG~G~fg~V~~a~~~~~~~~vAiK~i~~~~~~~~~~~~~~~E~~il~~l~HpnIV~~~~~~~~~~~~yiV  101 (350)
T 4b9d_A           22 SMEKYVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFEENGSLYIV  101 (350)
T ss_dssp             CCCCEEEEEEC------CEEEEEETTTCCEEEEEEEECTTSCHHHHHHHHHHHHHHHHCCCTTBCCEEEEEEETTEEEEE
T ss_pred             cccceEEeEEEecCCCeEEEEEEECCCCCEEEEEEEehHHCCHHHHHHHHHHHHHHHHCCCCCCCcEEEEEEECCEEEEE
Confidence            346899999999999999999995 569999999997654332  56799999999999999999999999999999999


Q ss_pred             EEcCCCCCHHhhhhccCCCCCCHHHHHHHHHHHHHHHHHHHhCCCcccccccCCcEEEcCCCCeEEccCCCcccCCCC--
Q 012608          101 AEYMPNETLAKHLFHWETHPMKWAMRLRVVLHLAQALEYCTSKGRALYHDLNAYRILFDEDGNPRLSTFGLMKNSRDG--  178 (460)
Q Consensus       101 ~e~~~g~sL~~~~~~~~~~~~~~~~~~~i~~qi~~~l~~lH~~~~iiH~Dikp~Nill~~~~~~kl~DFg~a~~~~~~--  178 (460)
                      ||||+||+|.+++....+..+++..++.|+.||+.||.|||+++ ||||||||+|||++.+|.+||+|||+++.....  
T Consensus       102 mEy~~gg~L~~~i~~~~~~~~~e~~~~~~~~qi~~aL~ylH~~~-IiHRDlKp~NILl~~~g~vKl~DFGla~~~~~~~~  180 (350)
T 4b9d_A          102 MDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRK-ILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVE  180 (350)
T ss_dssp             EECCTTCBHHHHHHHTTTCCCCHHHHHHHHHHHHHHHHHHHHTT-CEETTCCGGGEEECTTCCEEECSTTEESCCCHHHH
T ss_pred             EeCCCCCcHHHHHHHcCCCCCCHHHHHHHHHHHHHHHHHHHHCC-eeeccCCHHHEEECCCCCEEEcccccceeecCCcc
Confidence            99999999999997666677899999999999999999999999 999999999999999999999999999876543  


Q ss_pred             --CCccCCCcccCccccccCCCCCCCceehHHHHHHHHhhCCCCCCChhhhhhhhccccccccccccCCCCchhHHHHHH
Q 012608          179 --KSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQMLTDSCLEGQFTDDDGTELVR  256 (460)
Q Consensus       179 --~~~~~t~~y~aPE~~~~~~~~~~sDi~slG~~l~el~tg~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~  256 (460)
                        ....||+.|||||++.+..++.++|||||||++|||+||+.||.+.....+.........     ...+..+++++.+
T Consensus       181 ~~~~~~GT~~YmAPE~l~~~~y~~~~DiwSlGvilyemltG~~PF~~~~~~~~~~~i~~~~~-----~~~~~~~s~~~~~  255 (350)
T 4b9d_A          181 LARACIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSF-----PPVSLHYSYDLRS  255 (350)
T ss_dssp             HHHHHHSCCTTCCHHHHTTCCCCHHHHHHHHHHHHHHHHHSSCSCCCSSHHHHHHHHHHTCC-----CCCCTTSCHHHHH
T ss_pred             cccccCCCccccCHHHHCCCCCCcHHHHHHHHHHHHHHHHCCCCCCCcCHHHHHHHHHcCCC-----CCCCccCCHHHHH
Confidence              345799999999999999999999999999999999999999987655444333222111     1234567889999


Q ss_pred             HHHHHcccCCCCCCChhHHHH
Q 012608          257 LASRCLQYEPRERPNPKSLVT  277 (460)
Q Consensus       257 li~~~l~~~p~~Rps~~~il~  277 (460)
                      ||.+||+.||++|||+.++++
T Consensus       256 li~~~L~~dP~~R~s~~e~l~  276 (350)
T 4b9d_A          256 LVSQLFKRNPRDRPSVNSILE  276 (350)
T ss_dssp             HHHHHTCSSGGGSCCHHHHHT
T ss_pred             HHHHHccCChhHCcCHHHHhc
Confidence            999999999999999999986



>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 460
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 9e-42
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-41
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 8e-41
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 4e-40
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-39
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-39
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 9e-39
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 4e-38
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 3e-37
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 9e-36
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 2e-35
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 4e-35
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 5e-35
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 8e-35
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 1e-34
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 1e-34
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 2e-34
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 7e-34
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 1e-33
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 3e-33
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 9e-33
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-32
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-32
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 4e-32
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 6e-32
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 1e-31
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 7e-31
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 8e-31
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 1e-30
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-30
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 9e-30
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 6e-29
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 6e-29
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-28
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-28
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 6e-28
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-27
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 5e-27
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 9e-27
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 9e-27
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 8e-26
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-25
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 4e-25
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 2e-24
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 4e-24
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 7e-24
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 1e-23
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-23
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-22
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 4e-22
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 5e-22
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 6e-22
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 1e-21
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 2e-21
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 4e-20
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 1e-19
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 1e-19
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 3e-17
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 3e-16
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 2e-15
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 3e-14
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 3e-13
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 7e-07
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 1e-06
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 2e-04
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-04
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 7e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 7e-04
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 8e-04
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.002
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase Itk/Tsk
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  147 bits (371), Expect = 9e-42
 Identities = 52/249 (20%), Positives = 105/249 (42%), Gaps = 12/249 (4%)

Query: 41  VVYKGKLENQRRIAVKRFNRMAWPDPRQFLEEARSVGQLRNNRLTNLLGCCCEGDERLLV 100
           +V+ G   N+ ++A+K     A  +   F+EEA  + +L + +L  L G C E     LV
Sbjct: 20  LVHLGYWLNKDKVAIKTIREGAMSE-EDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLV 78

Query: 101 AEYMPNETLAKHLFHWETHPMKWAMRLRVVLHLAQALEYCTSKGRALYHDLNAYRILFDE 160
            E+M +  L+ +    +         L + L + + + Y       ++ DL A   L  E
Sbjct: 79  FEFMEHGCLSDY-LRTQRGLFAAETLLGMCLDVCEGMAYLEEAC-VIHRDLAARNCLVGE 136

Query: 161 DGNPRLSTFGLMKNSRDGKSYSTN-----LAFTPPEYLRTGRVTPESVIYSFGTLLLDLL 215
           +   ++S FG+ +   D +  S+      + +  PE     R + +S ++SFG L+ ++ 
Sbjct: 137 NQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVF 196

Query: 216 SGKHIPPSHALDLIRDRNLQMLTDSCLEGQFTDDDGTELVRLASRCLQYEPRERPNPKSL 275
           S   IP  +      +  +     +           T + ++ + C +  P +RP    L
Sbjct: 197 SEGKIPYEN----RSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRL 252

Query: 276 VTALSPLQK 284
           +  L+ + +
Sbjct: 253 LRQLAEIAE 261


>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query460
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.92
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.8
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.79
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.77
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.76
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.73
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.71
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.67
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.67
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.63
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.63
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.6
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.59
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.57
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.56
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.55
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.54
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.44
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.43
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.43
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.38
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.28
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.28
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.24
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.24
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.21
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.18
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.18
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.17
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.11
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 99.1
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.0
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.99
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.96
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 98.91
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.86
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.86
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.82
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.78
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.65
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.6
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.51
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.47
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.46
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 98.39
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.32
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.26
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.25
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.2
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 98.14
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.03
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.0
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 97.82
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.72
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.65
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 97.4
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 97.33
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.18
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 89.51
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 88.54
d1wr0a177 Vacuolar sorting protein 4b (VPS4B, SKD1 protein) 85.89
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 81.51
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: pak1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=9.1e-56  Score=410.43  Aligned_cols=244  Identities=20%  Similarity=0.273  Sum_probs=211.6

Q ss_pred             ccchhcccCCCCCCeEEEEE-EcCCcEEEEEEecCCCCCCHHHHHHHHHHHhcCCCCccceeeeEEeeCCeeEEEEEcCC
Q 012608           27 VENIVSEHGEKAPNVVYKGK-LENQRRIAVKRFNRMAWPDPRQFLEEARSVGQLRNNRLTNLLGCCCEGDERLLVAEYMP  105 (460)
Q Consensus        27 ~~~i~~~lg~G~~g~Vy~~~-~~~~~~vavK~~~~~~~~~~~~~~~E~~~l~~l~h~~iv~~~~~~~~~~~~~lv~e~~~  105 (460)
                      +|+++++||+|+||+||+|. ..+|+.||||+++.......+.+.+|+.++++++||||+++++++..++..|+|||||+
T Consensus        21 ~Y~~~~~iG~G~fg~Vy~a~~~~~~~~vAvK~~~~~~~~~~~~~~~E~~il~~l~HpnIv~~~~~~~~~~~~~ivmEy~~  100 (293)
T d1yhwa1          21 KYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLA  100 (293)
T ss_dssp             TBCSCEECCCSSSCEEEEEEBTTTCCEEEEEEEEGGGCSCHHHHHHHHHHHHHCCCTTBCCEEEEEEETTEEEEEEECCT
T ss_pred             ccEEEEEEecCcCcEEEEEEECCCCCEEEEEEEecccChHHHHHHHHHHHHHhCCCCCEeeEeEEEEECCEEEEEEEecC
Confidence            59999999999999999999 45799999999987666677889999999999999999999999999999999999999


Q ss_pred             CCCHHhhhhccCCCCCCHHHHHHHHHHHHHHHHHHHhCCCcccccccCCcEEEcCCCCeEEccCCCcccCCCC----CCc
Q 012608          106 NETLAKHLFHWETHPMKWAMRLRVVLHLAQALEYCTSKGRALYHDLNAYRILFDEDGNPRLSTFGLMKNSRDG----KSY  181 (460)
Q Consensus       106 g~sL~~~~~~~~~~~~~~~~~~~i~~qi~~~l~~lH~~~~iiH~Dikp~Nill~~~~~~kl~DFg~a~~~~~~----~~~  181 (460)
                      ||+|.+++..   +.+++..+..++.||+.||.|||++| |+||||||+|||++.++.+||+|||+++.....    ...
T Consensus       101 gg~L~~~~~~---~~l~~~~~~~i~~qi~~aL~yLH~~~-iiHrDiKp~NILl~~~~~vkl~DFG~a~~~~~~~~~~~~~  176 (293)
T d1yhwa1         101 GGSLTDVVTE---TCMDEGQIAAVCRECLQALEFLHSNQ-VIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTM  176 (293)
T ss_dssp             TCBHHHHHHH---SCCCHHHHHHHHHHHHHHHHHHHHTT-EECCCCSGGGEEECTTCCEEECCCTTCEECCSTTCCBCCC
T ss_pred             CCcHHHHhhc---cCCCHHHHHHHHHHHHHHHHHHHHCC-CcccCCcHHHeEECCCCcEeeccchhheeecccccccccc
Confidence            9999998753   56999999999999999999999999 999999999999999999999999999875432    355


Q ss_pred             cCCCcccCccccccCCCCCCCceehHHHHHHHHhhCCCCCCChhhhhhhhccccccccccccCCCCchhHHHHHHHHHHH
Q 012608          182 STNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQMLTDSCLEGQFTDDDGTELVRLASRC  261 (460)
Q Consensus       182 ~~t~~y~aPE~~~~~~~~~~sDi~slG~~l~el~tg~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~li~~~  261 (460)
                      .||+.|+|||++.+..++.++|||||||++|+|+||..||.+............   ...+....+..+++++.+||.+|
T Consensus       177 ~gt~~Y~aPE~~~~~~~~~~~DiwSlGvilyemltG~~Pf~~~~~~~~~~~~~~---~~~~~~~~~~~~s~~~~~li~~~  253 (293)
T d1yhwa1         177 VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIAT---NGTPELQNPEKLSAIFRDFLNRC  253 (293)
T ss_dssp             CSCGGGCCHHHHSSSCBCTHHHHHHHHHHHHHHHHSSCTTTTSCHHHHHHHHHH---HCSCCCSSGGGSCHHHHHHHHHH
T ss_pred             ccCCCccChhhhcCCCCCchhceehHhHHHHHHhhCCCCCCCCCHHHHHHHHHh---CCCCCCCCcccCCHHHHHHHHHH
Confidence            789999999999998999999999999999999999999976543222111111   11112234556789999999999


Q ss_pred             cccCCCCCCChhHHHH
Q 012608          262 LQYEPRERPNPKSLVT  277 (460)
Q Consensus       262 l~~~p~~Rps~~~il~  277 (460)
                      |+.||.+|||+.++++
T Consensus       254 L~~dP~~R~s~~eil~  269 (293)
T d1yhwa1         254 LDMDVEKRGSAKELLQ  269 (293)
T ss_dssp             TCSSTTTSCCHHHHTT
T ss_pred             ccCChhHCcCHHHHhc
Confidence            9999999999999987



>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure