BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 012648
         (459 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In
           Its Inward- Facing Conformation
          Length = 587

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 57/111 (51%), Gaps = 15/111 (13%)

Query: 155 LSLRIIK--RKLQWQD-GFREAGESAYCSVKKAFSSMVFIIRELHSFTLQMREILFYEDL 211
           L +R+++  R+ ++++  FR+A ES   S+  AFS +VF +  L  F + M  I      
Sbjct: 210 LGVRVVRAFRREEYENENFRKANESLRRSIISAFSLIVFAL-PLFIFIVNMGMIAVLW-F 267

Query: 212 QGILVRVQREMHASFV----WLFQQVFSHTPTLMVYVMILLANFTVHSMAS 258
            G+LVR  +    S +    +L Q +FS    LM+   IL  NF V + AS
Sbjct: 268 GGVLVRNNQMEIGSIMAYTNYLMQIMFS----LMMIGNIL--NFIVRASAS 312


>pdb|3A5C|A Chain A, Inter-Subunit Interaction And Quaternary Rearrangement
           Defined By The Central Stalk Of Prokaryotic V1-Atpase
 pdb|3A5C|B Chain B, Inter-Subunit Interaction And Quaternary Rearrangement
           Defined By The Central Stalk Of Prokaryotic V1-Atpase
 pdb|3A5C|C Chain C, Inter-Subunit Interaction And Quaternary Rearrangement
           Defined By The Central Stalk Of Prokaryotic V1-Atpase
 pdb|3A5C|I Chain I, Inter-Subunit Interaction And Quaternary Rearrangement
           Defined By The Central Stalk Of Prokaryotic V1-Atpase
 pdb|3A5C|J Chain J, Inter-Subunit Interaction And Quaternary Rearrangement
           Defined By The Central Stalk Of Prokaryotic V1-Atpase
 pdb|3A5C|K Chain K, Inter-Subunit Interaction And Quaternary Rearrangement
           Defined By The Central Stalk Of Prokaryotic V1-Atpase
 pdb|3A5D|A Chain A, Inter-Subunit Interaction And Quaternary Rearrangement
           Defined By The Central Stalk Of Prokaryotic V1-Atpase
 pdb|3A5D|B Chain B, Inter-Subunit Interaction And Quaternary Rearrangement
           Defined By The Central Stalk Of Prokaryotic V1-Atpase
 pdb|3A5D|C Chain C, Inter-Subunit Interaction And Quaternary Rearrangement
           Defined By The Central Stalk Of Prokaryotic V1-Atpase
 pdb|3A5D|I Chain I, Inter-Subunit Interaction And Quaternary Rearrangement
           Defined By The Central Stalk Of Prokaryotic V1-Atpase
 pdb|3A5D|J Chain J, Inter-Subunit Interaction And Quaternary Rearrangement
           Defined By The Central Stalk Of Prokaryotic V1-Atpase
 pdb|3A5D|K Chain K, Inter-Subunit Interaction And Quaternary Rearrangement
           Defined By The Central Stalk Of Prokaryotic V1-Atpase
 pdb|3J0J|A Chain A, Fitted Atomic Models Of Thermus Thermophilus V-Atpase
           Subunits Into Cryo-Em Map
 pdb|3J0J|B Chain B, Fitted Atomic Models Of Thermus Thermophilus V-Atpase
           Subunits Into Cryo-Em Map
 pdb|3J0J|C Chain C, Fitted Atomic Models Of Thermus Thermophilus V-Atpase
           Subunits Into Cryo-Em Map
          Length = 578

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 2/35 (5%)

Query: 158 RIIKRKLQWQDGFREAGESAYCSVKKAFSSMVFII 192
           RII+     Q+ + E    AYCS+KKA+  M  I+
Sbjct: 488 RIIREDFLQQNAYHEV--DAYCSMKKAYGIMKMIL 520


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.133    0.394 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,586,829
Number of Sequences: 62578
Number of extensions: 366255
Number of successful extensions: 894
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 894
Number of HSP's gapped (non-prelim): 2
length of query: 459
length of database: 14,973,337
effective HSP length: 102
effective length of query: 357
effective length of database: 8,590,381
effective search space: 3066766017
effective search space used: 3066766017
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)