Citrus Sinensis ID: 012676
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 458 | ||||||
| 255578319 | 456 | leucine-rich repeat-containing protein, | 0.980 | 0.984 | 0.709 | 1e-180 | |
| 297844192 | 463 | leucine-rich repeat family protein [Arab | 0.986 | 0.976 | 0.592 | 1e-151 | |
| 18391461 | 464 | ras group-related protein LRR 3 [Arabido | 0.989 | 0.976 | 0.584 | 1e-149 | |
| 8698744 | 492 | Contains similarity to CYR1 from Candida | 0.989 | 0.920 | 0.551 | 1e-144 | |
| 356497728 | 461 | PREDICTED: leucine-rich repeat-containin | 0.991 | 0.984 | 0.593 | 1e-141 | |
| 224110878 | 447 | predicted protein [Populus trichocarpa] | 0.888 | 0.910 | 0.630 | 1e-141 | |
| 449434977 | 501 | PREDICTED: protein scribble homolog [Cuc | 0.982 | 0.898 | 0.547 | 1e-141 | |
| 357485651 | 456 | Leucine-rich-repeat protein-like protein | 0.962 | 0.967 | 0.571 | 1e-140 | |
| 30688342 | 471 | plant intracellular ras group-related LR | 0.997 | 0.970 | 0.542 | 1e-138 | |
| 297818186 | 471 | leucine-rich repeat family protein [Arab | 0.997 | 0.970 | 0.552 | 1e-136 |
| >gi|255578319|ref|XP_002530026.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223530442|gb|EEF32326.1| leucine-rich repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 636 bits (1640), Expect = e-180, Method: Compositional matrix adjust.
Identities = 325/458 (70%), Positives = 372/458 (81%), Gaps = 9/458 (1%)
Query: 6 ENYPLLVFVLSQLNPNDHPPLPPQVYNNLITKYPHLTNSTVISSLTQGVPVQITQTRLLL 65
+ +P+L ++LSQL+PN HPPLP +Y NLIT++P L N VISSLTQ +P I Q+ LL
Sbjct: 3 QEFPILSYLLSQLDPNSHPPLPQVIYQNLITQFPQLNNPKVISSLTQSIPSTIIQSLFLL 62
Query: 66 ---GTRPDPDTVSAARSKLAQFQETATSSPEVDLYRAVVKLEEMHEDCERQFKEAEEMLD 122
G RPDPD VS AR K+ + ET EV++Y+AVV++EEMH + ERQ +E EE L
Sbjct: 63 KALGPRPDPDAVSTARIKIQELGETGK---EVEIYKAVVRMEEMHNEYERQLREVEERLS 119
Query: 123 RVYDSVSAEL--VDVNEDVVKILQEAESGVVVETVDLADRQLKLLPEAFGRLRGLVSLNL 180
VY +V E V VNE+VV IL++ ESG VVE VDL+ RQLKLLPEAFG+L GLV LNL
Sbjct: 120 GVYKNVVGEFEDVKVNEEVVSILKQVESGSVVERVDLSGRQLKLLPEAFGKLHGLVLLNL 179
Query: 181 SRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNVSGNKLNTLPESIAR 240
SRN LE +PDSIAGLQKLEELDVSSNLL SLPDSIGLL LKVLNVSGNKLN LPESIA
Sbjct: 180 SRNQLEVLPDSIAGLQKLEELDVSSNLLLSLPDSIGLLRTLKVLNVSGNKLNYLPESIAL 239
Query: 241 CSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEMRSLKYLDAHFNE 300
CSSLVELDASFNNLV LPTNIGYGL NLERLSI+LNK+ PPSICEM+SL+YLD HFNE
Sbjct: 240 CSSLVELDASFNNLVSLPTNIGYGLTNLERLSIQLNKIHILPPSICEMKSLRYLDVHFNE 299
Query: 301 LHGLPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQIRALPDTFFRLE 360
LHGLP AIG+LT LEVL+LSSNF+DLTELPET+GDL NLREL+LSNNQIRALPDTF RLE
Sbjct: 300 LHGLPYAIGRLTNLEVLDLSSNFSDLTELPETVGDLANLRELNLSNNQIRALPDTFGRLE 359
Query: 361 NLTKLNLDQNPLVIPPMEIVNKGVEAVKEFMAKRWDGIIAEAQQKSILEANKQQQAQSGW 420
NL L LD+NPLVIPP EIVNKGV+AV+EFM KRW +IAE QQ+ +LE N QQQ+Q+GW
Sbjct: 360 NLANLILDENPLVIPPKEIVNKGVQAVREFMQKRWLDMIAEEQQRRMLEVN-QQQSQTGW 418
Query: 421 LAWGSSMLTNFVSGVSQSVGGYLGGGKTSADPYLDQQL 458
LAWG+S+L NFVSGVSQSV GY+GG K DPYLDQQL
Sbjct: 419 LAWGNSLLNNFVSGVSQSVSGYIGGTKPPQDPYLDQQL 456
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297844192|ref|XP_002889977.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297335819|gb|EFH66236.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18391461|ref|NP_563921.1| ras group-related protein LRR 3 [Arabidopsis thaliana] gi|17063165|gb|AAL32979.1| At1g12970/F13K23_18 [Arabidopsis thaliana] gi|21700931|gb|AAM70589.1| At1g12970/F13K23_18 [Arabidopsis thaliana] gi|57868148|gb|AAW57412.1| plant intracellular Ras-group-related LRR protein 3 [Arabidopsis thaliana] gi|332190834|gb|AEE28955.1| ras group-related protein LRR 3 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|8698744|gb|AAF78502.1|AC012187_22 Contains similarity to CYR1 from Candida albicans gb|AB034965 and contains multiple Leucine Rich PF|00560 repeats [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356497728|ref|XP_003517711.1| PREDICTED: leucine-rich repeat-containing protein 7-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224110878|ref|XP_002315667.1| predicted protein [Populus trichocarpa] gi|222864707|gb|EEF01838.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449434977|ref|XP_004135272.1| PREDICTED: protein scribble homolog [Cucumis sativus] gi|449478610|ref|XP_004155368.1| PREDICTED: protein scribble homolog [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357485651|ref|XP_003613113.1| Leucine-rich-repeat protein-like protein [Medicago truncatula] gi|355514448|gb|AES96071.1| Leucine-rich-repeat protein-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|30688342|ref|NP_189281.2| plant intracellular ras group-related LRR 2 [Arabidopsis thaliana] gi|9293927|dbj|BAB01830.1| leucine-rich-repeat protein-like [Arabidopsis thaliana] gi|26453000|dbj|BAC43576.1| unknown protein [Arabidopsis thaliana] gi|29824149|gb|AAP04035.1| unknown protein [Arabidopsis thaliana] gi|57868146|gb|AAW57411.1| plant intracellular Ras-group-related LRR protein 2 [Arabidopsis thaliana] gi|332643646|gb|AEE77167.1| plant intracellular ras group-related LRR 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297818186|ref|XP_002876976.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297322814|gb|EFH53235.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 458 | ||||||
| TAIR|locus:2010326 | 464 | PIRL3 "AT1G12970" [Arabidopsis | 0.989 | 0.976 | 0.586 | 2.2e-137 | |
| TAIR|locus:2088807 | 471 | PIRL2 "AT3G26500" [Arabidopsis | 0.997 | 0.970 | 0.544 | 2e-127 | |
| TAIR|locus:2166429 | 506 | PIRL1 "plant intracellular ras | 0.825 | 0.747 | 0.542 | 4.2e-102 | |
| TAIR|locus:2074728 | 499 | PIRL9 "plant intracellular ras | 0.768 | 0.705 | 0.571 | 1.9e-99 | |
| TAIR|locus:2117617 | 549 | PIRL4 "plant intracellular ras | 0.641 | 0.535 | 0.401 | 4.6e-50 | |
| TAIR|locus:2120825 | 383 | PIRL8 "AT4G26050" [Arabidopsis | 0.604 | 0.723 | 0.408 | 6.7e-49 | |
| TAIR|locus:2827587 | 526 | PIRL5 "AT2G17440" [Arabidopsis | 0.641 | 0.558 | 0.406 | 6.7e-49 | |
| TAIR|locus:2123899 | 373 | PIRL7 "plant intracellular ras | 0.554 | 0.680 | 0.431 | 1.1e-48 | |
| TAIR|locus:2047595 | 380 | PIRL6 "AT2G19330" [Arabidopsis | 0.537 | 0.647 | 0.449 | 2.9e-48 | |
| WB|WBGene00002632 | 699 | let-413 [Caenorhabditis elegan | 0.491 | 0.321 | 0.416 | 6.2e-35 |
| TAIR|locus:2010326 PIRL3 "AT1G12970" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1345 (478.5 bits), Expect = 2.2e-137, P = 2.2e-137
Identities = 275/469 (58%), Positives = 347/469 (73%)
Query: 1 MNPNPENYPLLVFVLSQLNPNDHPPLPPQVYNNLITKYPHLTNSTVISSLTQGVPVQITQ 60
M+ + E +PLL +VL +P H P + +L +YP LTN VISSL + +P ITQ
Sbjct: 1 MDHDLEIFPLLSYVLHHSDPASHAPPSLAIQQSLANRYPLLTNPYVISSLIESIPSTITQ 60
Query: 61 TRLL---LGTRPDPDTVSAARSKLAQFQETATSSPE-----VDLYRAVVKLEEMHEDCER 112
T + LG RPDP VS+ARSK+ + +E + SPE +Y AVV LEE+HE E+
Sbjct: 61 TLFVFGSLGPRPDPLAVSSARSKIREIKENDSLSPEDAAKEEQVYAAVVSLEEVHEGYEK 120
Query: 113 QFKEAEEMLDRVYDSVSAELV---DVNEDVVKILQEAESGVVVETVDLADRQLKLLPEAF 169
Q ++ EE + RVY S L +VNE+V+ ++++AE G VVE +DL+D +LKLLP+A
Sbjct: 121 QLRDLEEEIGRVYASAVESLSGGDEVNEEVLAVIKDAEDGGVVERIDLSDHELKLLPDAL 180
Query: 170 GRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNVSGN 229
G++ GLVSLN+SRN L +PD+I+GL+KLEELD+SSN L LPDSIGLLLNL++LNV+GN
Sbjct: 181 GKIVGLVSLNVSRNNLRFLPDTISGLEKLEELDLSSNRLVFLPDSIGLLLNLRILNVTGN 240
Query: 230 KLNTLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEMR 289
KL LPESIA+C SLVELDASFNNL LP N GYGLLNLERLSI+LNK+R FP SICEMR
Sbjct: 241 KLTLLPESIAQCRSLVELDASFNNLTSLPANFGYGLLNLERLSIQLNKIRFFPNSICEMR 300
Query: 290 SLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQI 349
SL+YLDAH NE+HGLP AIG+LT LEV+NLSSNF+DL ELP+TI DL NLRELDLSNNQI
Sbjct: 301 SLRYLDAHMNEIHGLPIAIGRLTNLEVMNLSSNFSDLIELPDTISDLANLRELDLSNNQI 360
Query: 350 RALPDTFFRLENLTKLNLDQNPLVIPPMEIVNKGVEAVKEFMAKRWDGIIAEAQQKSILE 409
R LPD+FFRLE L KLNLDQNPL PP E+VN+ EAV+EFM KRW+ ++ E Q +S++E
Sbjct: 361 RVLPDSFFRLEKLEKLNLDQNPLEYPPQEMVNQSAEAVREFMRKRWEEMVEEEQLRSVIE 420
Query: 410 ANKQQQAQSGWLAWGSSMLTNFVSGVSQSVGGYLGGGKTSADPYLDQQL 458
A KQQ +GWL+WGSS++T+ SG G + G K + +LD+QL
Sbjct: 421 AEKQQGGATGWLSWGSSIVTSLFSG-----GTHGGAAKKPKNSFLDEQL 464
|
|
| TAIR|locus:2088807 PIRL2 "AT3G26500" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166429 PIRL1 "plant intracellular ras group-related LRR 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2074728 PIRL9 "plant intracellular ras group-related LRR 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2117617 PIRL4 "plant intracellular ras group-related LRR 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2120825 PIRL8 "AT4G26050" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2827587 PIRL5 "AT2G17440" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2123899 PIRL7 "plant intracellular ras group-related LRR 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2047595 PIRL6 "AT2G19330" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00002632 let-413 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh2_kg.1__1405__AT1G12970.1 | annotation not avaliable (463 aa) | |||||||
(Arabidopsis lyrata) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 458 | |||
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 2e-18 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-16 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 2e-16 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 4e-16 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-13 | |
| PRK15370 | 754 | PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl | 4e-13 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-10 | |
| PRK15387 | 788 | PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss | 5e-10 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 2e-09 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 3e-09 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-08 | |
| PRK15370 | 754 | PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl | 3e-08 | |
| PRK15370 | 754 | PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl | 4e-08 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 3e-07 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 2e-06 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 5e-06 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 7e-06 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 7e-06 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 3e-05 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 5e-05 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 6e-05 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 7e-05 | |
| PRK15370 | 754 | PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl | 2e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 2e-04 | |
| pfam12799 | 43 | pfam12799, LRR_4, Leucine Rich repeats (2 copies) | 2e-04 | |
| pfam12799 | 43 | pfam12799, LRR_4, Leucine Rich repeats (2 copies) | 2e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 4e-04 | |
| cd00116 | 319 | cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo | 4e-04 | |
| smart00370 | 24 | smart00370, LRR, Leucine-rich repeats, outliers | 7e-04 | |
| smart00369 | 24 | smart00369, LRR_TYP, Leucine-rich repeats, typical | 7e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.001 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.001 | |
| cd00116 | 319 | cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo | 0.001 | |
| pfam12799 | 43 | pfam12799, LRR_4, Leucine Rich repeats (2 copies) | 0.004 |
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
Score = 86.6 bits (214), Expect = 2e-18
Identities = 67/223 (30%), Positives = 104/223 (46%), Gaps = 5/223 (2%)
Query: 152 VETVDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSL 211
++ +DL+D +++ LP L L +L+LS N L +P ++ L L LD+S N + L
Sbjct: 142 LKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKISDL 201
Query: 212 PDSIGLLLNLKVLNVSGNKLNTLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERL 271
P I LL L+ L++S N + L S++ +L L+ S N L LP +IG L NLE L
Sbjct: 202 PPEIELLSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIG-NLSNLETL 260
Query: 272 SIKLNKLRTFPPSICEMRSLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFNDLTELPE 331
+ N + S+ + +L+ LD N L I L L L L+ LT
Sbjct: 261 DL-SNNQISSISSLGSLTNLRELDLSGNSLSNALPLIALLLLLLELLLN---LLLTLKAL 316
Query: 332 TIGDLINLRELDLSNNQIRALPDTFFRLENLTKLNLDQNPLVI 374
+ L ++ +N + P+ LE+L L N L
Sbjct: 317 ELKLNSILLNNNILSNGETSSPEALSILESLNNLWTLDNALDE 359
|
Length = 394 |
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|197688 smart00370, LRR, Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >gnl|CDD|197687 smart00369, LRR_TYP, Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 458 | |||
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.93 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.92 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.92 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.91 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.91 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.9 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.89 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.89 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.82 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.82 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.81 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.81 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.79 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.78 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.77 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.76 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.75 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.74 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.73 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.71 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.68 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.68 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.67 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.54 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.52 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.51 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.49 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 99.46 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.45 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.36 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.36 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.34 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 99.33 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 99.31 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.25 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 99.19 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.02 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.91 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.88 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.87 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.78 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.78 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.75 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.66 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.65 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.63 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.62 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 98.57 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 98.56 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.55 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.51 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.42 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 98.4 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.38 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.35 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.2 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 98.2 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.18 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.01 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.93 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.87 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.53 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.53 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.37 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 97.36 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 97.34 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 97.28 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.2 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 96.86 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 96.65 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.39 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.05 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.48 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.21 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 94.97 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 94.69 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 94.43 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 93.7 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 90.66 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 90.66 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 89.54 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 89.54 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 89.27 | |
| smart00364 | 26 | LRR_BAC Leucine-rich repeats, bacterial type. | 82.41 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 81.96 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 80.5 |
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
Probab=99.93 E-value=9.8e-28 Score=235.55 Aligned_cols=229 Identities=34% Similarity=0.459 Sum_probs=158.1
Q ss_pred CCCceeEEEecCCCCCccchhhCCCCCCcEEEcccCCCCccchh-hcCCcccceeeeecCCCCCCchhhcCCCCccEEEe
Q 012676 148 SGVVVETVDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMPDS-IAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNV 226 (458)
Q Consensus 148 ~~~~L~~L~l~~~~l~~l~~~~~~l~~L~~L~l~~n~i~~l~~~-l~~l~~L~~L~L~~n~l~~l~~~l~~l~~L~~L~l 226 (458)
.++.|+.|||++|.++++|..+..-+++-+|+|++|+|..||.. +.++..|-.||||+|++..+|+.+..+..|++|.|
T Consensus 101 ~l~dLt~lDLShNqL~EvP~~LE~AKn~iVLNLS~N~IetIPn~lfinLtDLLfLDLS~NrLe~LPPQ~RRL~~LqtL~L 180 (1255)
T KOG0444|consen 101 RLKDLTILDLSHNQLREVPTNLEYAKNSIVLNLSYNNIETIPNSLFINLTDLLFLDLSNNRLEMLPPQIRRLSMLQTLKL 180 (1255)
T ss_pred ccccceeeecchhhhhhcchhhhhhcCcEEEEcccCccccCCchHHHhhHhHhhhccccchhhhcCHHHHHHhhhhhhhc
Confidence 34778888888888888888777777888888888888877754 56777777778888777777777777777777777
Q ss_pred eCCCCC--------------------------CCchhhcCCCCCcEEEcCCCCCCcCCchhhccCCCCCEEeccCCcCcc
Q 012676 227 SGNKLN--------------------------TLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRT 280 (458)
Q Consensus 227 ~~n~l~--------------------------~l~~~l~~l~~L~~L~l~~n~l~~l~~~~~~~l~~L~~L~L~~n~l~~ 280 (458)
++|.+. .+|.++..+.+|..+|++.|++..+|..++ .+++|+.|+|++|.|+.
T Consensus 181 s~NPL~hfQLrQLPsmtsL~vLhms~TqRTl~N~Ptsld~l~NL~dvDlS~N~Lp~vPecly-~l~~LrrLNLS~N~ite 259 (1255)
T KOG0444|consen 181 SNNPLNHFQLRQLPSMTSLSVLHMSNTQRTLDNIPTSLDDLHNLRDVDLSENNLPIVPECLY-KLRNLRRLNLSGNKITE 259 (1255)
T ss_pred CCChhhHHHHhcCccchhhhhhhcccccchhhcCCCchhhhhhhhhccccccCCCcchHHHh-hhhhhheeccCcCceee
Confidence 776542 344455566667777777777777766555 67777777777777776
Q ss_pred CCccccCCCCCcEEEcccCCCCCccccccCCCcccEEEccCCCCCCCccchhhcCCCCCCEEeccCCCCCCCchhhhCCC
Q 012676 281 FPPSICEMRSLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQIRALPDTFFRLE 360 (458)
Q Consensus 281 l~~~l~~l~~L~~L~l~~n~l~~l~~~l~~l~~L~~L~L~~n~~~~~~l~~~l~~l~~L~~L~L~~n~l~~l~~~l~~l~ 360 (458)
+....+.-.+|++|+++.|+++.+|.++.++++|+.|.+.+|......+|..++.+.+|+.+..++|.+.-+|+.+..|.
T Consensus 260 L~~~~~~W~~lEtLNlSrNQLt~LP~avcKL~kL~kLy~n~NkL~FeGiPSGIGKL~~Levf~aanN~LElVPEglcRC~ 339 (1255)
T KOG0444|consen 260 LNMTEGEWENLETLNLSRNQLTVLPDAVCKLTKLTKLYANNNKLTFEGIPSGIGKLIQLEVFHAANNKLELVPEGLCRCV 339 (1255)
T ss_pred eeccHHHHhhhhhhccccchhccchHHHhhhHHHHHHHhccCcccccCCccchhhhhhhHHHHhhccccccCchhhhhhH
Confidence 65555555666777777777777777777777777777766655556666666666666666666666666666666666
Q ss_pred CCcEEECcCCCCCCCcH
Q 012676 361 NLTKLNLDQNPLVIPPM 377 (458)
Q Consensus 361 ~L~~L~L~~n~i~~~~~ 377 (458)
+|+.|.|+.|.+...|.
T Consensus 340 kL~kL~L~~NrLiTLPe 356 (1255)
T KOG0444|consen 340 KLQKLKLDHNRLITLPE 356 (1255)
T ss_pred HHHHhcccccceeechh
Confidence 66666666666555443
|
|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00364 LRR_BAC Leucine-rich repeats, bacterial type | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 458 | ||||
| 2o6q_A | 270 | Structural Diversity Of The Hagfish Variable Lympho | 2e-17 | ||
| 3rfs_A | 272 | Design Of A Binding Scaffold Based On Variable Lymp | 5e-13 | ||
| 3rfj_A | 279 | Design Of A Binding Scaffold Based On Variable Lymp | 2e-12 | ||
| 4fcg_A | 328 | Structure Of The Leucine-Rich Repeat Domain Of The | 2e-10 | ||
| 4fcg_A | 328 | Structure Of The Leucine-Rich Repeat Domain Of The | 1e-05 | ||
| 2o6s_A | 208 | Structural Diversity Of The Hagfish Variable Lympho | 3e-10 | ||
| 3rgx_A | 768 | Structural Insight Into Brassinosteroid Perception | 5e-10 | ||
| 3riz_A | 772 | Crystal Structure Of The Plant Steroid Receptor Bri | 6e-10 | ||
| 1g9u_A | 454 | Crystal Structure Of Yopm-leucine Rich Effector Pro | 2e-08 | ||
| 2z66_A | 306 | Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A | 4e-08 | ||
| 2o6r_A | 177 | Structural Diversity Of The Hagfish Variable Lympho | 4e-08 | ||
| 3e6j_A | 229 | Crystal Structure Of Variable Lymphocyte Receptor ( | 6e-08 | ||
| 1sq0_B | 288 | Crystal Structure Of The Complex Of The Wild-Type V | 9e-08 | ||
| 3g06_A | 622 | The Salmonella Virulence Effector Ssph2 Functions A | 1e-07 | ||
| 1m10_B | 290 | Crystal Structure Of The Complex Of Glycoprotein Ib | 1e-07 | ||
| 1m0z_A | 290 | Crystal Structure Of The Von Willebrand Factor Bind | 1e-07 | ||
| 3p72_A | 269 | Structure Of Platelet Glycoprotein 1b Alpha With A | 2e-07 | ||
| 1u0n_D | 265 | The Ternary Von Willebrand Factor A1-Glycoprotein I | 2e-07 | ||
| 1p9a_G | 290 | Crystal Structure Of N-terminal Domain Of Human Pla | 4e-07 | ||
| 1p8v_A | 279 | Crystal Structure Of The Complex Of Platelet Recept | 4e-07 | ||
| 1ook_G | 290 | Crystal Structure Of The Complex Of Platelet Recept | 5e-07 | ||
| 3pmh_G | 290 | Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib | 5e-07 | ||
| 1gwb_B | 281 | Structure Of Glycoprotein 1b Length = 281 | 5e-07 | ||
| 2z63_A | 570 | Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A | 2e-06 | ||
| 3m19_A | 251 | Crystal Structure Of Variable Lymphocyte Receptor V | 5e-06 | ||
| 3zyo_A | 411 | Crystal Structure Of The N-Terminal Leucine Rich Re | 6e-06 | ||
| 3zyn_A | 321 | Crystal Structure Of The N-Terminal Leucine Rich Re | 8e-06 | ||
| 3fxi_A | 605 | Crystal Structure Of The Human Tlr4-Human Md-2-E.Co | 9e-06 | ||
| 4g8a_A | 635 | Crystal Structure Of Human Tlr4 Polymorphic Variant | 1e-05 | ||
| 3m18_A | 251 | Crystal Structure Of Variable Lymphocyte Receptor V | 2e-05 | ||
| 3m18_A | 251 | Crystal Structure Of Variable Lymphocyte Receptor V | 2e-05 | ||
| 3oja_B | 597 | Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 | 4e-05 | ||
| 2id5_A | 477 | Crystal Structure Of The Lingo-1 Ectodomain Length | 8e-05 | ||
| 3o6n_A | 390 | Crystal Structure Of Apl1 Leucine-Rich Repeat Domai | 8e-05 | ||
| 3a79_B | 562 | Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len | 1e-04 | ||
| 2z80_A | 353 | Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu | 1e-04 | ||
| 4b8c_D | 727 | Nuclease Module Of The Yeast Ccr4-Not Complex Lengt | 2e-04 | ||
| 4arn_A | 279 | Crystal Structure Of The N-terminal Domain Of Droso | 3e-04 | ||
| 2z81_A | 549 | Crystal Structure Of The Tlr1-tlr2 Heterodimer Indu | 4e-04 | ||
| 3cvr_A | 571 | Crystal Structure Of The Full Length Ipah3 Length = | 4e-04 | ||
| 4eco_A | 636 | Crystal Structure Of A Hypothetical Protein (Bacegg | 4e-04 | ||
| 3ul8_A | 279 | Crystal Structure Of The Tv3 Mutant V134l Length = | 4e-04 | ||
| 3a79_A | 580 | Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len | 5e-04 | ||
| 3v47_A | 455 | Crystal Structure Of The N-Tetminal Fragment Of Zeb | 6e-04 | ||
| 2z64_A | 599 | Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp | 6e-04 | ||
| 3ula_A | 279 | Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito | 6e-04 | ||
| 3ul7_A | 278 | Crystal Structure Of The Tv3 Mutant F63w Length = 2 | 6e-04 | ||
| 3vq1_A | 606 | Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE | 6e-04 | ||
| 3zyj_A | 440 | Netring1 In Complex With Ngl1 Length = 440 | 7e-04 | ||
| 3ul9_A | 278 | Structure Of The Tv3 Mutant M41e Length = 278 | 8e-04 |
| >pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 | Back alignment and structure |
|
| >pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 | Back alignment and structure |
| >pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 | Back alignment and structure |
| >pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 | Back alignment and structure |
| >pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 | Back alignment and structure |
| >pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 | Back alignment and structure |
| >pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 | Back alignment and structure |
| >pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 | Back alignment and structure |
| >pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 | Back alignment and structure |
| >pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 | Back alignment and structure |
| >pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 | Back alignment and structure |
| >pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 | Back alignment and structure |
| >pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 | Back alignment and structure |
| >pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 | Back alignment and structure |
| >pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 | Back alignment and structure |
| >pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 | Back alignment and structure |
| >pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 | Back alignment and structure |
| >pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 | Back alignment and structure |
| >pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 | Back alignment and structure |
| >pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 | Back alignment and structure |
| >pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 | Back alignment and structure |
| >pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 | Back alignment and structure |
| >pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 | Back alignment and structure |
| >pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 | Back alignment and structure |
| >pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 | Back alignment and structure |
| >pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 | Back alignment and structure |
| >pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 | Back alignment and structure |
| >pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 | Back alignment and structure |
| >pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 | Back alignment and structure |
| >pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 | Back alignment and structure |
| >pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 | Back alignment and structure |
| >pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 | Back alignment and structure |
| >pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 | Back alignment and structure |
| >pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 | Back alignment and structure |
| >pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 | Back alignment and structure |
| >pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 | Back alignment and structure |
| >pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 | Back alignment and structure |
| >pdb|4ARN|A Chain A, Crystal Structure Of The N-terminal Domain Of Drosophila Toll Receptor Length = 279 | Back alignment and structure |
| >pdb|2Z81|A Chain A, Crystal Structure Of The Tlr1-tlr2 Heterodimer Induced By Binding Of A Tri-acylated Lipopeptide Length = 549 | Back alignment and structure |
| >pdb|3CVR|A Chain A, Crystal Structure Of The Full Length Ipah3 Length = 571 | Back alignment and structure |
| >pdb|4ECO|A Chain A, Crystal Structure Of A Hypothetical Protein (Bacegg_03329) From Bacteroides Eggerthii Dsm 20697 At 2.70 A Resolution Length = 636 | Back alignment and structure |
| >pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 | Back alignment and structure |
| >pdb|3A79|A Chain A, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 580 | Back alignment and structure |
| >pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 | Back alignment and structure |
| >pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 | Back alignment and structure |
| >pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 | Back alignment and structure |
| >pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 | Back alignment and structure |
| >pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 | Back alignment and structure |
| >pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 | Back alignment and structure |
| >pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 458 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-67 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 6e-53 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 7e-50 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-44 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-20 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 4e-56 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-49 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-08 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 9e-48 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 1e-41 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 1e-32 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 2e-11 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-46 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-44 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 5e-43 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 5e-42 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-36 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-31 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-30 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 9e-29 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-19 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-45 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 4e-39 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-20 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 9e-17 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 1e-44 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-39 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-39 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 4e-31 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 1e-29 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 8e-20 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 8e-44 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 8e-44 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-43 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-41 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-37 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 5e-32 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 7e-30 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 5e-15 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 6e-42 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 4e-37 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 6e-37 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-35 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 6e-34 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 3e-15 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 4e-41 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 3e-39 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 4e-34 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 4e-26 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 3e-23 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-12 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-40 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 7e-35 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 8e-34 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-23 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-21 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-18 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-17 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 6e-16 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 7e-40 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-29 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-21 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 9e-39 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 1e-37 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 2e-35 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-38 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 7e-30 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-19 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-38 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-26 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-15 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-38 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 4e-35 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 4e-34 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 5e-32 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 4e-31 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-17 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 5e-14 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-38 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 8e-36 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-34 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 6e-34 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 7e-34 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-33 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-30 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-27 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 9e-24 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-23 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-38 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 5e-37 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 6e-34 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-33 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-31 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-31 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 6e-30 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-29 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-29 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 9e-27 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-26 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-23 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-18 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 8e-38 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-36 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 9e-36 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-33 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-32 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-30 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-29 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 6e-25 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-22 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 5e-37 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 4e-33 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 4e-33 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 2e-16 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 6e-37 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-35 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-33 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-31 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-28 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 4e-28 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-26 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-24 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-22 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-36 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-34 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-34 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 4e-29 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-14 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 4e-36 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-35 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 1e-34 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 3e-34 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 7e-32 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 1e-19 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 6e-11 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 6e-04 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 4e-36 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 5e-36 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 5e-25 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-12 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 5e-35 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 4e-33 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 6e-32 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 2e-27 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 2e-16 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 5e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 7e-35 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-34 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-29 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-28 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-27 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-26 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-24 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-21 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 7e-18 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-15 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-34 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-32 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 7e-31 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 5e-30 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-26 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 9e-24 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-23 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-23 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-23 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 4e-34 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 1e-25 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 1e-16 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 8e-34 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-32 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 6e-30 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-29 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-28 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 8e-28 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-21 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-06 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 9e-34 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-32 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-27 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-24 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-24 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-23 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 7e-23 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-18 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-32 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-22 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-19 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-11 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 4e-32 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 3e-31 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 1e-24 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 4e-23 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 3e-10 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 5e-29 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 2e-27 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 7e-23 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 6e-14 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 9e-10 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 3e-28 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 3e-28 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 1e-27 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 4e-26 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-25 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 3e-27 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 4e-26 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 1e-25 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 1e-04 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 2e-26 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 2e-20 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 1e-18 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 2e-26 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 4e-22 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 4e-26 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 1e-25 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 3e-22 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 1e-10 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-25 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-17 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 3e-15 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 6e-13 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 6e-13 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 4e-12 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-25 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 1e-15 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 1e-13 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-12 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 1e-24 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 1e-19 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-17 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 4e-15 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 4e-24 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 2e-16 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 6e-15 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 9e-15 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 1e-13 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 1e-13 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 2e-10 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 5e-24 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 1e-23 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 1e-23 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 5e-18 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 2e-15 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 4e-15 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 1e-14 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 1e-22 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 5e-17 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 1e-16 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 1e-21 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 1e-21 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 1e-17 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 2e-20 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 4e-15 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 3e-14 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 6e-13 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 2e-20 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 8e-16 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 3e-14 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 2e-13 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 5e-13 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 2e-20 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 4e-17 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 2e-13 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 7e-20 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 6e-19 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 3e-15 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 1e-13 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 4e-11 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 2e-19 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 4e-11 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 5e-11 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 4e-09 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 9e-05 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 6e-18 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 4e-16 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 6e-07 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 3e-17 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 4e-16 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 1e-10 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 8e-09 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 2e-05 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 8e-15 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 1e-11 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 8e-08 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 1e-07 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 4e-14 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 4e-11 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 1e-08 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 3e-07 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 5e-14 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 2e-12 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 5e-10 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 2e-09 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 2e-13 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 7e-11 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 2e-06 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 5e-12 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 1e-04 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 9e-11 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 4e-09 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 1e-10 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 8e-10 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 3e-09 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 1e-08 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 5e-07 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 6e-06 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 1e-10 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 4e-10 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 3e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-10 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 2e-10 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 3e-09 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-08 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 4e-08 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 6e-08 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-07 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-08 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 4e-08 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 3e-07 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-05 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 3e-04 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 8e-08 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 1e-07 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-07 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 6e-07 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 3e-04 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 6e-07 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 9e-07 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 3e-05 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 4e-05 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 1e-06 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-06 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 9e-06 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-04 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 5e-06 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-05 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-04 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 9e-06 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 2e-05 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-05 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 3e-05 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
Score = 217 bits (554), Expect = 3e-67
Identities = 69/239 (28%), Positives = 99/239 (41%), Gaps = 14/239 (5%)
Query: 156 DLADRQLKLLPEAFGRLR--GLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPD 213
R LK + G V+L L L PD L L+ + + + L LPD
Sbjct: 62 TRTGRALKATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAGLMELPD 121
Query: 214 SIGLLLNLKVLNVSGNKLNTLPESIARCSSLVELDASFNN-LVCLPTNIG--------YG 264
++ L+ L ++ N L LP SIA + L EL L LP + G
Sbjct: 122 TMQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQG 181
Query: 265 LLNLERLSIKLNKLRTFPPSICEMRSLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFN 324
L+NL+ L ++ +R+ P SI +++LK L + L L AI L +LE L+L
Sbjct: 182 LVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGC-T 240
Query: 325 DLTELPETIGDLINLRELDLSN-NQIRALPDTFFRLENLTKLNLDQNP-LVIPPMEIVN 381
L P G L+ L L + + + LP RL L KL+L L P I
Sbjct: 241 ALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQ 299
|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 458 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.96 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.95 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.95 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.95 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.94 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.94 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.94 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.94 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.94 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.94 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.94 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.94 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.94 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.94 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.94 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.93 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.93 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.93 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.93 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.93 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.93 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.93 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.93 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.93 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.93 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.93 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.93 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.93 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.93 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.93 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.93 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.93 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.93 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.93 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.92 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.92 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.92 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.92 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.92 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.92 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.92 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.92 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.92 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.92 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.92 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.91 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.91 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.91 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.91 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.91 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.91 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.91 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.91 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.91 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.91 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.91 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.9 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.9 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.9 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.9 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.9 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.9 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.9 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.89 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.89 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.89 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.89 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.89 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.89 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.89 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.89 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.89 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.89 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.88 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.88 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.88 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.88 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.87 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.87 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.86 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.86 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.86 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.86 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.85 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.85 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.85 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.84 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.84 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.84 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.83 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.83 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.83 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.82 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.82 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.82 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.81 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.81 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.81 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.81 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.79 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.79 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.78 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.78 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.78 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.77 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.77 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.76 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.75 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.75 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.75 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.75 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.75 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.75 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.74 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.71 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.7 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.69 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.68 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.65 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.64 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.63 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.62 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.62 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.61 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.61 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.6 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.59 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.59 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.59 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.55 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.55 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.54 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.53 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.53 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.53 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.52 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 99.46 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 99.45 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.39 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.38 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.37 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.35 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.3 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.3 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.12 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.12 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.93 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.91 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 98.9 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 98.81 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.8 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 98.8 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.73 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 98.51 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 98.31 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 98.21 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.13 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.12 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 97.97 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 97.94 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.85 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.83 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.78 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.75 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
Probab=99.96 E-value=1.2e-28 Score=240.26 Aligned_cols=227 Identities=26% Similarity=0.332 Sum_probs=205.5
Q ss_pred CCCceeEEEecCCCCCccchhhCCCCCCcEEEcccCCCCccchhhcCCcccceeeeecCCCCCCchhhcCCCCccEEEee
Q 012676 148 SGVVVETVDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNVS 227 (458)
Q Consensus 148 ~~~~L~~L~l~~~~l~~l~~~~~~l~~L~~L~l~~n~i~~l~~~l~~l~~L~~L~L~~n~l~~l~~~l~~l~~L~~L~l~ 227 (458)
....++.|++++|.++.+|..+..+++|++|++++|.++.+|..++++++|++|++++|.++.+|..+.++++|++|+++
T Consensus 79 ~~~~l~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~ 158 (328)
T 4fcg_A 79 TQPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRALPASIASLNRLRELSIR 158 (328)
T ss_dssp TSTTCCEEEEESSCCSSCCSCGGGGTTCSEEEEESSCCCCCCSCGGGGTTCSEEEEESCCCCCCCGGGGGCTTCCEEEEE
T ss_pred cccceeEEEccCCCchhcChhhhhCCCCCEEECCCCCccchhHHHhccCCCCEEECCCCccccCcHHHhcCcCCCEEECC
Confidence 35779999999999999999899999999999999999999999999999999999999999999999999999999999
Q ss_pred CCC-CCCCchhhcC---------CCCCcEEEcCCCCCCcCCchhhccCCCCCEEeccCCcCccCCccccCCCCCcEEEcc
Q 012676 228 GNK-LNTLPESIAR---------CSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEMRSLKYLDAH 297 (458)
Q Consensus 228 ~n~-l~~l~~~l~~---------l~~L~~L~l~~n~l~~l~~~~~~~l~~L~~L~L~~n~l~~l~~~l~~l~~L~~L~l~ 297 (458)
+|+ +..+|..+.. +++|++|++++|.++.+|..+. .+++|++|++++|.++.+|..+..+++|++|+++
T Consensus 159 ~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~l~-~l~~L~~L~L~~N~l~~l~~~l~~l~~L~~L~Ls 237 (328)
T 4fcg_A 159 ACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIA-NLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLR 237 (328)
T ss_dssp EETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEECCCCCCGGGG-GCTTCCEEEEESSCCCCCCGGGGGCTTCCEEECT
T ss_pred CCCCccccChhHhhccchhhhccCCCCCEEECcCCCcCcchHhhc-CCCCCCEEEccCCCCCcCchhhccCCCCCEEECc
Confidence 974 4577776654 9999999999999999987754 8999999999999999999999999999999999
Q ss_pred cCCCCC-ccccccCCCcccEEEccCCCCCCCccchhhcCCCCCCEEeccCCCCC-CCchhhhCCCCCcEEECcCCCCCCC
Q 012676 298 FNELHG-LPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQIR-ALPDTFFRLENLTKLNLDQNPLVIP 375 (458)
Q Consensus 298 ~n~l~~-l~~~l~~l~~L~~L~L~~n~~~~~~l~~~l~~l~~L~~L~L~~n~l~-~l~~~l~~l~~L~~L~L~~n~i~~~ 375 (458)
+|.+.+ +|..++.+++|++|++++| ...+.+|..++.+++|+.|++++|++. .+|..++++++|+.+++..+.+...
T Consensus 238 ~n~~~~~~p~~~~~l~~L~~L~L~~n-~~~~~~p~~~~~l~~L~~L~L~~n~~~~~iP~~l~~L~~L~~l~l~~~~~~~l 316 (328)
T 4fcg_A 238 GCTALRNYPPIFGGRAPLKRLILKDC-SNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANCIILVPPHLQAQL 316 (328)
T ss_dssp TCTTCCBCCCCTTCCCCCCEEECTTC-TTCCBCCTTGGGCTTCCEEECTTCTTCCCCCGGGGGSCTTCEEECCGGGSCC-
T ss_pred CCcchhhhHHHhcCCCCCCEEECCCC-CchhhcchhhhcCCCCCEEeCCCCCchhhccHHHhhccCceEEeCCHHHHHHH
Confidence 988776 7888999999999999998 456788989999999999999998655 7899999999999999998877654
Q ss_pred c
Q 012676 376 P 376 (458)
Q Consensus 376 ~ 376 (458)
.
T Consensus 317 ~ 317 (328)
T 4fcg_A 317 D 317 (328)
T ss_dssp -
T ss_pred h
Confidence 3
|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 458 | ||||
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-21 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-15 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 3e-08 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 8e-08 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-05 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-04 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 4e-04 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 6e-20 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 2e-17 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 5e-14 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 6e-18 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 1e-05 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 2e-05 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 2e-04 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 8e-04 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 2e-13 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 5e-13 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-11 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 8e-11 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 3e-10 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-09 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-09 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 5e-08 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-07 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-06 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 3e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 3e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.004 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 8e-11 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 2e-07 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 0.002 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 3e-10 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 6e-10 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 2e-09 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 7e-08 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 1e-07 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 4e-05 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 4e-10 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 2e-07 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 2e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 0.003 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 4e-10 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 0.004 | |
| d2omxa2 | 199 | c.10.2.1 (A:37-235) Internalin B {Listeria monocyt | 8e-10 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 9e-09 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-08 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 3e-07 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 7e-06 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 8e-06 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 3e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 8e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 1e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 3e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 5e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 8e-04 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 1e-07 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 1e-07 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 3e-07 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 6e-07 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 2e-05 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 2e-07 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 2e-06 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 5e-06 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 1e-04 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 6e-04 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 0.001 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 0.001 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 2e-07 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 8e-05 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 0.001 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 0.004 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 2e-07 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 4e-07 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 2e-05 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 7e-05 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 0.002 | |
| d1m9la_ | 198 | c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree | 1e-06 | |
| d1m9la_ | 198 | c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree | 8e-05 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 3e-06 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 6e-05 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 7e-05 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 8e-05 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 1e-04 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 2e-04 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 3e-04 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 0.002 | |
| d2ifga3 | 156 | c.10.2.7 (A:36-191) High affinity nerve growth fac | 4e-06 | |
| d2ifga3 | 156 | c.10.2.7 (A:36-191) High affinity nerve growth fac | 5e-04 | |
| d2ifga3 | 156 | c.10.2.7 (A:36-191) High affinity nerve growth fac | 6e-04 | |
| d1w8aa_ | 192 | c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga | 3e-05 |
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Internalin LRR domain domain: Internalin A species: Listeria monocytogenes [TaxId: 1639]
Score = 93.9 bits (232), Expect = 1e-21
Identities = 45/202 (22%), Positives = 89/202 (44%), Gaps = 11/202 (5%)
Query: 169 FGRLRGLVSLNLSRNLLEAMPDSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNVSG 228
+L L SL + N + + L L+EL ++ N L+ + ++ L NL L+++
Sbjct: 193 LAKLTNLESLIATNNQISDITPLG-ILTNLDELSLNGNQLKDIG-TLASLTNLTDLDLAN 250
Query: 229 NKLNTLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEM 288
N+++ L ++ + L EL N + + G L I +
Sbjct: 251 NQISNLA-PLSGLTKLTELKLGANQISNISPLAG---LTALTNLELNENQLEDISPISNL 306
Query: 289 RSLKYLDAHFNELHGLPRAIGKLTRLEVLNLSSNFNDLTELPETIGDLINLRELDLSNNQ 348
++L YL +FN + + + LT+L+ L ++N ++++ + +L N+ L +NQ
Sbjct: 307 KNLTYLTLYFNNISDIS-PVSSLTKLQRLFFANNK--VSDVSS-LANLTNINWLSAGHNQ 362
Query: 349 IRALPDTFFRLENLTKLNLDQN 370
I L L +T+L L+
Sbjct: 363 ISDLTP-LANLTRITQLGLNDQ 383
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 458 | |||
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.9 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.9 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.9 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.89 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.89 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.89 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.88 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.87 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.85 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.84 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.83 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.82 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.8 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.8 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.79 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.79 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.76 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.75 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.7 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.66 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.65 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.64 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.64 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.63 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.62 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.61 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.6 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.59 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.57 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.56 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.5 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.47 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.46 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.44 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.28 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.22 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.41 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.37 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.32 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.21 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.01 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 97.8 |
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Ngr ectodomain-like domain: von Willebrand factor binding domain of glycoprotein Ib alpha species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90 E-value=4.8e-23 Score=192.23 Aligned_cols=200 Identities=32% Similarity=0.400 Sum_probs=141.2
Q ss_pred CCCceeEEEecCCCCCccchhhCCCCCCcEEEcccCCCCccc-hhhcCCcccceeeeecCCCCCCchhhcCCCCccEEEe
Q 012676 148 SGVVVETVDLADRQLKLLPEAFGRLRGLVSLNLSRNLLEAMP-DSIAGLQKLEELDVSSNLLQSLPDSIGLLLNLKVLNV 226 (458)
Q Consensus 148 ~~~~L~~L~l~~~~l~~l~~~~~~l~~L~~L~l~~n~i~~l~-~~l~~l~~L~~L~L~~n~l~~l~~~l~~l~~L~~L~l 226 (458)
+...+.++++++++++.+|..+. +++++|+|++|.|+.++ ..|.++++|++|++++|+|+.++. ++.+++|++|++
T Consensus 8 ~~~~~~~v~C~~~~L~~iP~~lp--~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N~l~~l~~-~~~l~~L~~L~L 84 (266)
T d1p9ag_ 8 KVASHLEVNCDKRNLTALPPDLP--KDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQV-DGTLPVLGTLDL 84 (266)
T ss_dssp CSTTCCEEECTTSCCSSCCSCCC--TTCCEEECTTSCCSEEEGGGGTTCTTCCEEECTTSCCCEEEC-CSCCTTCCEEEC
T ss_pred ccCCCeEEEccCCCCCeeCcCcC--cCCCEEECcCCcCCCcCHHHhhcccccccccccccccccccc-cccccccccccc
Confidence 34455667788888887776554 46778888888887776 457777788888888887777653 456777777777
Q ss_pred eCCCCCCCchhhcCCCCCcEEEcCCCCCCcCCchhhccCCCCCEEeccCCcCccCCccccCCCCCcEEEcccCCCCCccc
Q 012676 227 SGNKLNTLPESIARCSSLVELDASFNNLVCLPTNIGYGLLNLERLSIKLNKLRTFPPSICEMRSLKYLDAHFNELHGLPR 306 (458)
Q Consensus 227 ~~n~l~~l~~~l~~l~~L~~L~l~~n~l~~l~~~~~~~l~~L~~L~L~~n~l~~l~~~l~~l~~L~~L~l~~n~l~~l~~ 306 (458)
++|+++..+..+..+++|+.|++++|.+..++...+.. +.++++|++++|.++.++.
T Consensus 85 s~N~l~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~-----------------------l~~l~~L~l~~n~l~~l~~ 141 (266)
T d1p9ag_ 85 SHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRG-----------------------LGELQELYLKGNELKTLPP 141 (266)
T ss_dssp CSSCCSSCCCCTTTCTTCCEEECCSSCCCCCCSSTTTT-----------------------CTTCCEEECTTSCCCCCCT
T ss_pred ccccccccccccccccccccccccccccceeecccccc-----------------------ccccccccccccccceecc
Confidence 77777766666666667777777666666555444434 4455555555555555442
Q ss_pred -cccCCCcccEEEccCCCCCCCccc-hhhcCCCCCCEEeccCCCCCCCchhhhCCCCCcEEECcCCCCCCC
Q 012676 307 -AIGKLTRLEVLNLSSNFNDLTELP-ETIGDLINLRELDLSNNQIRALPDTFFRLENLTKLNLDQNPLVIP 375 (458)
Q Consensus 307 -~l~~l~~L~~L~L~~n~~~~~~l~-~~l~~l~~L~~L~L~~n~l~~l~~~l~~l~~L~~L~L~~n~i~~~ 375 (458)
.+..+++|+.|++++| .+..++ ..+..+++|++|+|++|+|+.+|..+..+++|+.|+|++|++.+.
T Consensus 142 ~~~~~l~~l~~l~l~~N--~l~~~~~~~~~~l~~L~~L~Ls~N~L~~lp~~~~~~~~L~~L~L~~Np~~Cd 210 (266)
T d1p9ag_ 142 GLLTPTPKLEKLSLANN--NLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCN 210 (266)
T ss_dssp TTTTTCTTCCEEECTTS--CCSCCCTTTTTTCTTCCEEECCSSCCCCCCTTTTTTCCCSEEECCSCCBCCS
T ss_pred ccccccccchhcccccc--cccccCccccccccccceeecccCCCcccChhHCCCCCCCEEEecCCCCCCC
Confidence 4455667777777776 444554 346778899999999999999988888899999999999999864
|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|