Citrus Sinensis ID: 012680


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
MRDIRRALLEADVSLPVVRRFVQAVSEQAVGVGLIRGVRPDQQLVKIVRDELVKLMGGEVSELVFAKSRPTVILLAGLQGVGKTTVSAKLANYLKKQGKSCMLVAGDVYRPAAIDQLVILGEQVGVPVYTAGTEVKPSQIAKQGLEEAKKKNVDVVIVDTAGRLQIDKAMMDELKDVKRVLNPTEVLLVVDAMTGQEAAALVTTFNIEIGITGAILTKLDGDSRGGAALSVKEVSGKPIKLVGRGERMEDLEPFYPDRMAGRILGMGDVLSFVEKAQEVMQQEDAEEMQKKIMSANFDFNDFLKQTRTVARMGSMSRVIGMIPGMGKITPAQVREAEKSLKIMEAMIEAMTPEEREKPELLAESPVRRKRVAQDSGKTEQQVSQLVAQLFQMRVRMKNLMGVMEGGSLPALSNLEDALKSEQKAPPGTARRKRRSESRRQFVDPASTRPSPRGFGGGS
cHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccEEEHHHHHHHHHHHccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHccccEEcccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHcccccEEEEccccccccccccccHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccHHHHcccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHcccccccccHHHccccccccccccccccccccccccccc
MRDIRRALLEADVSLPVVRRFVQAVSEQAVGVGLIRGVRPDQQLVKIVRDELVKLMGGEVSELVFAKSRPTVILLAGLQGVGKTTVSAKLANYLKKQGKSCMLVAGDVYRPAAIDQLVILGEQVGVPVYTAGTEVKPSQIAKQGLEEAKKKNVDVVIVDTAGRLQIDKAMMDELKDVKRVLNPTEVLLVVDAMTGQEAAALVTTFNIEIGITGAILTKLDGDSRGGAALSVKEVSGKPIKLVGRGERMEDLEPFYPDRMAGRILGMGDVLSFVEKAQEVM***********IM*ANFDFNDFLKQTRTVARMGSMSRVIGMIPGMGK*************KIMEAMIEAMTPEEREKPELLAESPV*RKRVAQDSGKTEQQVSQLVAQLFQMRVRMKN************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRDIRRALLEADVSLPVVRRFVQAVSEQAVGVGLIRGVRPDQQLVKIVRDELVKLMGGEVSELVFAKSRPTVILLAGLQGVGKTTVSAKLANYLKKQGKSCMLVAGDVYRPAAIDQLVILGEQVGVPVYTAGTEVKPSQIAKQGLEEAKKKNVDVVIVDTAGRLQIDKAMMDELKDVKRVLNPTEVLLVVDAMTGQEAAALVTTFNIEIGITGAILTKLDGDSRGGAALSVKEVSGKPIKLVGRGERMEDLEPFYPDRMAGRILGMGDVLSFVEKAQEVMQQEDAEEMQKKIMSANFDFNDFLKQTRTVARMGSMSRVIGMIPGMGKITPAQVREAEKSLKIMEAMIEAMTPEEREKPELLAESPVRRKRVAQDSGKTEQQVSQLVAQLFQMRVRMKNLMGVMEGGSLPALSNLEDALKSEQKAPPGTARRKRRSESRRQFVDPASTRPSPRGFGGGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal recognition particle 54 kDa protein, chloroplastic Involved in cotranslational and post-translational sorting of thylakoid proteins. Binds GTP specifically. Activates the GTPase activity of CPFTSY when bound together. Required for light-harvesting chlorophyll a/b-binding protein (LHCP) integration into thylakoids.confidentP37107
Signal recognition particle protein Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds to the hydrophobic signal sequence of the ribosome-nascent chain (RNC) as it emerges from the ribosomes. The SRP-RNC complex is then targeted to the cytoplasmic membrane where it interacts with the SRP receptor FtsY. Interaction with FtsY leads to the transfer of the RNC complex to the Sec translocase for insertion into the membrane, the hydrolysis of GTP by both Ffh and FtsY, and the dissociation of the SRP-FtsY complex into the individual components.probableP37105
Signal recognition particle 54 kDa protein Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds to the hydrophobic signal sequence of the ribosome-nascent chain (RNC) as it emerges from the ribosomes. The SRP-RNC complex is then targeted to the cytoplasmic membrane where it interacts with the SRP receptor FtsY.probableO27376

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XXA, chain A
Confidence level:very confident
Coverage over the Query: 1-321,336-394
View the alignment between query and template
View the model in PyMOL
Template: 2J37, chain W
Confidence level:very confident
Coverage over the Query: 1-445
View the alignment between query and template
View the model in PyMOL