Query         012690
Match_columns 458
No_of_seqs    26 out of 28
Neff          2.3 
Searched_HMMs 46136
Date          Fri Mar 29 05:17:47 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/012690.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/012690hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF09588 YqaJ:  YqaJ-like viral  40.4      18 0.00039   30.7   1.7   18  315-332   135-152 (152)
  2 PF01465 GRIP:  GRIP domain;  I  37.5      29 0.00063   26.1   2.2   24  255-279     9-32  (46)
  3 PF04277 OAD_gamma:  Oxaloaceta  31.8      34 0.00073   27.0   1.9   22    1-23      1-22  (79)
  4 PF00023 Ank:  Ankyrin repeat H  29.2      46 0.00099   22.0   1.9   21  147-167    11-31  (33)
  5 COG3630 OadG Na+-transporting   23.8      50  0.0011   28.6   1.7   22    3-25      9-30  (84)
  6 PF03765 CRAL_TRIO_N:  CRAL/TRI  21.8      71  0.0015   23.6   2.0   24  254-277    30-54  (55)
  7 PF14967 FAM70:  FAM70 protein   20.6      88  0.0019   32.7   2.9   26   48-73    302-327 (327)
  8 PF08105 Antimicrobial10:  Metc  19.4 2.1E+02  0.0046   23.1   4.2    6   35-40     28-33  (52)
  9 PRK02919 oxaloacetate decarbox  16.0 1.2E+02  0.0027   25.6   2.3   17   10-26     15-31  (82)
 10 PF15234 LAT:  Linker for activ  14.3 5.5E+02   0.012   25.8   6.5   52   30-81     30-86  (230)

No 1  
>PF09588 YqaJ:  YqaJ-like viral recombinase domain;  InterPro: IPR019080  This protein is found in many different bacterial species but is of viral origin. The protein forms an oligomer and functions as a processive alkaline exonuclease that digests linear double-stranded DNA in a Mg(2+)-dependent reaction, It has a preference for 5'-phosphorylated DNA ends. It thus forms part of the two-component SynExo viral recombinase functional unit []. ; PDB: 3SZ5_A 3SZ4_A 3SYY_A 3K93_A 1AVQ_A 3SM4_C 3SLP_A.
Probab=40.37  E-value=18  Score=30.71  Aligned_cols=18  Identities=22%  Similarity=0.313  Sum_probs=15.7

Q ss_pred             hHHHHHHhhhHhhhhhhh
Q 012690          315 MESYVSHLQKQSLITNLQ  332 (458)
Q Consensus       315 ~~sYvs~lQkQ~lITNlQ  332 (458)
                      -+.|...+|-||+||++|
T Consensus       135 p~~Y~~QvQ~qm~vtg~e  152 (152)
T PF09588_consen  135 PHYYYAQVQHQMAVTGAE  152 (152)
T ss_dssp             HHHHHHHHHHHHHHHT-S
T ss_pred             CHHHHHHHHHHHHHHCcC
Confidence            678999999999999976


No 2  
>PF01465 GRIP:  GRIP domain;  InterPro: IPR000237 The GRIP (golgin-97, RanBP2alpha,Imh1p and p230/golgin-245) domain [, , ] is found in many large coiled-coil proteins. It has been shown to be sufficient for targeting to the Golgi []. The GRIP domain contains a completely conserved tyrosine residue.; GO: 0005515 protein binding, 0000042 protein targeting to Golgi; PDB: 1R4A_H 1UPT_B.
Probab=37.52  E-value=29  Score=26.13  Aligned_cols=24  Identities=29%  Similarity=0.581  Sum_probs=18.1

Q ss_pred             hhHHHHHhhcCCCcchHHHHhhhhc
Q 012690          255 KSIVLRWLGSKLDPSRSKEVLRGLS  279 (458)
Q Consensus       255 K~VVl~wLa~KL~p~~An~~lR~LS  279 (458)
                      ||||++||..+= ++....+++.|+
T Consensus         9 KNvl~~fl~~~~-~~~~~~llpvi~   32 (46)
T PF01465_consen    9 KNVLLQFLESRE-PSEREQLLPVIA   32 (46)
T ss_dssp             HHHHHHHHTTSS----HHHHHHHHH
T ss_pred             HHHHHHHhcCCc-hhhHHHHHHHHH
Confidence            899999999985 777888888775


No 3  
>PF04277 OAD_gamma:  Oxaloacetate decarboxylase, gamma chain ;  InterPro: IPR005899  This family comprises distantly related, low complexity, hydrophobic small subunits of several related sodium ion-pumping decarboxylases. These include oxaloacetate decarboxylase gamma subunit and methylmalonyl-CoA decarboxylase delta subunit [].; GO: 0008948 oxaloacetate decarboxylase activity, 0015081 sodium ion transmembrane transporter activity, 0071436 sodium ion export, 0016020 membrane
Probab=31.76  E-value=34  Score=27.03  Aligned_cols=22  Identities=41%  Similarity=0.860  Sum_probs=11.1

Q ss_pred             CCccccchhhhHHHHHHHHHHHH
Q 012690            1 MSEGISLNLSLSMGLLVLFLLLL   23 (458)
Q Consensus         1 m~~g~~~~~~~s~~~~~~~~l~~   23 (458)
                      |.+|+.+-+ ++|+.+|++|.+|
T Consensus         1 ~~~gl~i~i-~Gm~iVF~~L~lL   22 (79)
T PF04277_consen    1 MIEGLQIMI-IGMGIVFLVLILL   22 (79)
T ss_pred             CchHHHHHH-HHHHHHHHHHHHH
Confidence            455665543 4555555544443


No 4  
>PF00023 Ank:  Ankyrin repeat Hereditary spherocytosis;  InterPro: IPR002110  The ankyrin repeat is one of the most common protein-protein interaction motifs in nature. Ankyrin repeats are tandemly repeated modules of about 33 amino acids. They occur in a large number of functionally diverse proteins mainly from eukaryotes. The few known examples from prokaryotes and viruses may be the result of horizontal gene transfers []. The repeat has been found in proteins of diverse function such as transcriptional initiators, cell-cycle regulators, cytoskeletal, ion transporters and signal transducers. The ankyrin fold appears to be defined by its structure rather than its function since there is no specific sequence or structure which is universally recognised by it.  The conserved fold of the ankyrin repeat unit is known from several crystal and solution structures [, , , ]. Each repeat folds into a helix-loop-helix structure with a beta-hairpin/loop region projecting out from the helices at a 90o angle. The repeats stack together to form an L-shaped structure [, ].; GO: 0005515 protein binding; PDB: 1D9S_A 1NFI_F 1IKN_D 1WDY_A 1OT8_C 1QYM_A 1TR4_A 1UOH_A 1N11_A 1K1A_A ....
Probab=29.17  E-value=46  Score=22.01  Aligned_cols=21  Identities=19%  Similarity=0.341  Sum_probs=17.1

Q ss_pred             hhhHHHHHHHHhhCCCccccc
Q 012690          147 EHCLSDFEQILVGQGAADDLK  167 (458)
Q Consensus       147 ~~C~SDi~~iL~sqGAn~~l~  167 (458)
                      .+--.|+.++|+++||+-++.
T Consensus        11 ~~~~~~~v~~Ll~~ga~~~~~   31 (33)
T PF00023_consen   11 QRGHPDIVKLLLKHGADINAR   31 (33)
T ss_dssp             HTTCHHHHHHHHHTTSCTTCB
T ss_pred             HHHHHHHHHHHHHCcCCCCCC
Confidence            344679999999999998765


No 5  
>COG3630 OadG Na+-transporting methylmalonyl-CoA/oxaloacetate decarboxylase, gamma subunit [Energy production and conversion]
Probab=23.84  E-value=50  Score=28.61  Aligned_cols=22  Identities=50%  Similarity=0.942  Sum_probs=13.3

Q ss_pred             ccccchhhhHHHHHHHHHHHHhh
Q 012690            3 EGISLNLSLSMGLLVLFLLLLCF   25 (458)
Q Consensus         3 ~g~~~~~~~s~~~~~~~~l~~~~   25 (458)
                      ||+-+-+ +.|+|+|+||.+|..
T Consensus         9 eg~~L~v-lGmg~VflfL~iLi~   30 (84)
T COG3630           9 EGITLMV-LGMGFVFLFLSILIY   30 (84)
T ss_pred             HHHHHHH-HHHHHHHHHHHHHHH
Confidence            4444433 577777777776543


No 6  
>PF03765 CRAL_TRIO_N:  CRAL/TRIO, N-terminal domain;  InterPro: IPR008273 This entry defines the N-terminal of various retinaldehyde/retinal-binding proteins that may be functional components of the visual cycle. Cellular retinaldehyde-binding protein (CRALBP) carries 11-cis-retinol or 11-cis-retinaldehyde as endogenous ligands and may function as a substrate carrier protein that modulates interaction of these retinoids with visual cycle enzymes []. The multidomain protein Trio binds the LAR transmembrane tyrosine phosphatase, contains a protein kinase domain, and has separate rac-specific and rho-specific guanine nucleotide exchange factor domains []. Trio is a multifunctional protein that integrates and amplifies signals involved in coordinating actin remodeling, which is necessary for cell migration and growth. Other members of the family are transfer proteins that include, guanine nucleotide exchange factor that may function as an effector of RAC1, phosphatidylinositol/phosphatidylcholine transfer protein that is required for the transport of secretory proteins from the golgi complex and alpha-tocopherol transfer protein that enhances the transfer of the ligand between separate membranes.; PDB: 1OIZ_A 1R5L_A 1OIP_A 3HX3_A 3HY5_A 1AUA_A 3Q8G_A 3B7Q_B 3B7Z_A 3B7N_A ....
Probab=21.84  E-value=71  Score=23.62  Aligned_cols=24  Identities=25%  Similarity=0.484  Sum_probs=20.0

Q ss_pred             chhHHHHHh-hcCCCcchHHHHhhh
Q 012690          254 CKSIVLRWL-GSKLDPSRSKEVLRG  277 (458)
Q Consensus       254 CK~VVl~wL-a~KL~p~~An~~lR~  277 (458)
                      -.++++||| |+|.+-+.|.+||+.
T Consensus        30 ~d~~llRFLRARkf~v~~A~~mL~~   54 (55)
T PF03765_consen   30 DDNFLLRFLRARKFDVEKAFKMLKK   54 (55)
T ss_dssp             SHHHHHHHHHHTTT-HHHHHHHHHH
T ss_pred             CHHHHHHHHHHccCCHHHHHHHHHh
Confidence            449999999 799999999999874


No 7  
>PF14967 FAM70:  FAM70 protein
Probab=20.61  E-value=88  Score=32.71  Aligned_cols=26  Identities=46%  Similarity=0.754  Sum_probs=19.0

Q ss_pred             CcCcccCCCCCCCCCCCCCCCCCCCC
Q 012690           48 DLLPEIPPSEAPQPFLPLLAPSPLAP   73 (458)
Q Consensus        48 ~~~~eisPs~~P~~~~P~la~sPm~P   73 (458)
                      ++.+..+|--.|.+|.|.|-|||-+|
T Consensus       302 ~lp~~aPp~y~P~yf~PgEKPPPYaP  327 (327)
T PF14967_consen  302 GLPPNAPPRYAPPYFPPGEKPPPYAP  327 (327)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCcCCCC
Confidence            44455556667888999999998766


No 8  
>PF08105 Antimicrobial10:  Metchnikowin family;  InterPro: IPR012513 This family consists of the metchnikowin family of antimicrobial peptides from Drosophila. metchnikowin is a proline-rich peptide whose expression is immune-inducible. Induction of the metchnikowin gene expression can be mediated either by the TOLL pathway or by the imd gene product. The metchnikowin peptide is unique among the Drosophila antimicrobial peptides in that it is active against both bacteria and fungi [].
Probab=19.36  E-value=2.1e+02  Score=23.09  Aligned_cols=6  Identities=33%  Similarity=0.506  Sum_probs=3.9

Q ss_pred             ccccce
Q 012690           35 NLKGHI   40 (458)
Q Consensus        35 ~~~~~~   40 (458)
                      +++|++
T Consensus        28 r~qgpi   33 (52)
T PF08105_consen   28 RRQGPI   33 (52)
T ss_pred             hccCCC
Confidence            666666


No 9  
>PRK02919 oxaloacetate decarboxylase subunit gamma; Provisional
Probab=16.03  E-value=1.2e+02  Score=25.64  Aligned_cols=17  Identities=47%  Similarity=0.843  Sum_probs=11.3

Q ss_pred             hhHHHHHHHHHHHHhhh
Q 012690           10 SLSMGLLVLFLLLLCFH   26 (458)
Q Consensus        10 ~~s~~~~~~~~l~~~~~   26 (458)
                      .+.|++||+||.+|.+-
T Consensus        15 vlGMg~VfvFL~lLI~~   31 (82)
T PRK02919         15 FLGMGFVLAFLFLLIFA   31 (82)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            46777777777765543


No 10 
>PF15234 LAT:  Linker for activation of T-cells
Probab=14.35  E-value=5.5e+02  Score=25.76  Aligned_cols=52  Identities=23%  Similarity=0.336  Sum_probs=32.1

Q ss_pred             cCCccccccceeeccc-cCCcCcccCCCCCCCCCC----CCCCCCCCCCCCCCCCCc
Q 012690           30 CSSMYNLKGHISVNRR-VDDLLPEIPPSEAPQPFL----PLLAPSPLAPFTNSTVPK   81 (458)
Q Consensus        30 ~s~~~~~~~~~~~~~~-~~~~~~eisPs~~P~~~~----P~la~sPm~Pf~n~~~Pk   81 (458)
                      |--+-+.-++...+.- -.++++.-.+...|.|.-    |.+.++-|.|.+.+--|-
T Consensus        30 CReLpgSydsa~~dsl~p~si~ik~p~t~~pwp~avts~pplsqPDLLpIPRSPQp~   86 (230)
T PF15234_consen   30 CRELPGSYDSASSDSLYPRSIVIKRPQTLAPWPPAVTSYPPLSQPDLLPIPRSPQPP   86 (230)
T ss_pred             HhhCCCccccCCCCCCCCcceEecCCCCCCCCCcccccCCCCCCcccccCCCCCCCC
Confidence            4433344444444333 256788888888887765    667777788877665553


Done!