Citrus Sinensis ID: 012703

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46

MWLSFSCKEEDCCRHDLPPKAKRFESFFTQLYSVTLASCNELICKDFFLSMEGNQFGLFATSTAQIHDAPTTGRAIQGVPFIEKITFHLLRLEDGVVLDEKVFHNDFINLAHNMGVFLYDDLLAIVSLRYQTIHILQVRDLGNLVDVRTIGSFCREDDELFLISNSQSLATSERSRLNPFPGNQVGNGHNQVNQDDSFLSGIKQRLLSFIFQGMWNEETDQAMRVQSLKKKFFFHFQDYVDLIIWKVQFLDRHHLLIKFGSVDGGVSRNVDHHPAFFAVYNMETTEVVAFYQNSAEELYFLFEKFCDHFHATSRNSLHMNFISSHSNNVYALEQLRSIKNKGGSFSQFVKKMMASLPFGCQSQSPSPYFDQSLFRYDEKLISATDRHRQSTDHPIKFISRRPPYTLKFKIKPGPEAGTIDGRTKRISSFLFHPFLPLALSIQQTLFLQPSVVNIHFRR

cccccccccccccccccccccHHHHHHHHccEEEEEccccEEEEEEEEEEECccCEEEEEEcccccccccccccccccccccccEEEEEEEccccEEEEEEEEcccEEEEcccccEEEEccHHHHHHccEEEEEEEEEEccccEEEEEECccccccccHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcHHHHHHHHHEEEEEccccEEEEEECccccccccccccccEEEEEEEEcccEEEEEEcccHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEEEcccccccccccccEEEEEEEcccccEEEEEEECcccccEEEEEEEcc

MWLSFSCKEEDCCRHDLPPKAKRFESFFTQLYSVTLASCNELICKDFFLSMEGNQFGLFATSTAQIHDAPTTGRAIQGVPFIEKITFHLLRLEDGVVLDEKVFHNDFINLAHNMGVFLYDDLLAIVSLRYQTIHILQVRDLGNLVDVRTIGSFCREDDELFLISNSQS****************************SFLSGIKQRLLSFIFQGMWNEETDQAMRVQSLKKKFFFHFQDYVDLIIWKVQFLDRHHLLIKFGSVDGGVSRNVDHHPAFFAVYNMETTEVVAFYQNSAEELYFLFEKFCDHFHATSRNSLHMNFISSHSNNVYALEQLRSIKNKGGSFSQFVKKMMASLPFGCQSQSPSPYFDQSLFRYDEKLISATDRHRQSTDHPIKFISRRPPYTLKFKIKPGPEAGTIDGRTKRISSFLFHPFLPLALSIQQTLFLQPSVVNIHFRR

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Light-mediated development protein DET1	Component of light signal transduction machinery. Involved in repression of photomorphogenesis in darkness by participating in the CDD complex, a complex probably required to regulate the activity of ubiquitin conjugating enzymes (E2s). Involved in repression of deetiolation in the developing seedling. Repression of photomorphogenesis is probably mediated by ubiquitination and subsequent degradation of photomorphogenesis-promoting factors such as HY5, HYH and LAF1. Involved in the repression of blue light responsive promoter in chloroplasts. May be required to stabilize the CDD complex. Its association with histone tail suggests a role in remodeling of chromatin.	confident	P48732
Light-mediated development protein DET1	Component of light signal transduction machinery. Involved in fruit pigmentation and fruit nutritional quality. Acts as a negative regulator of fruit pigmentation. Probably acts by participating in the CDD complex, a complex probably required to regulate the activity of ubiquitin conjugating enzymes. Repression of photomorphogenesis is probably mediated by ubiquitination and subsequent degradation of photomorphogenesis-promoting factors such as HY5.	probable	Q9ZNU6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!