Citrus Sinensis ID: 012726

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------

MAKTKEKKVNVSGKPKHSLDANRTDGKSGSRSASTVRRLNMYKTRPKRDRKGKVLQHEFQSKELPNTRIQPDRRWFGNTRCVNQKQLEFFREELQSHMSSSYNVILREKKLPFSLLNDHQKQARVHLLDTEPFQDAFGPKGKRKRPKLLASDYESLVKRADGSQDAFEQKNDASTSAEGVEGDGFRDLVRHTMFEKGQSKRIWGELYKVIDSSDVVVQVLDARDPQGTRCHHLERHLKEHCKHKHMILLLNKCDLVPAWATKGWLRVLSKEYPSLAFHASINKSFGKGSLLSVLRQFARLKSDKQAISVGFVGYPNVGKSSVINTLRTKNVCKVAPIPGETKVWQYITLTKRIFLIDCPGVVYQNKDSETDIVLKGVVRVTNLEDAAEHIGEVLKRVKKEHLKRAYKIKDWVDENDFLLQLCKSTGKLLRVCLFLHFISWYLFFYDHITNLASVGHL

ccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccCEEEcHHHHHHHHHHHHHHHccccEEccccccccccccccHHHHHHHccccccccHHHccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHcccccccHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHcccccccccccccEEEEEEEEEcccEEEECccccccccccccHHHHHHcccccccHHcHHHHHHHHHHHccHHHHHHHHcccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccccc

********************************ASTVRRLNMYKTRPKRDRKGKVLQ***********RIQPDRRWFGNTRCVNQKQLEFFREELQSHMSSSYNVILREKKLPFSLLNDH****RVHLL********************************************************FRDLVRHTMFEKGQSKRIWGELYKVIDSSDVVVQVLDARDPQGTRCHHLERHLKEHCKHKHMILLLNKCDLVPAWATKGWLRVLSKEYPSLAFHASINKSFGKGSLLSVLRQFARLKSDKQAISVGFVGYPNVGKSSVINTLRTKNVCKVAPIPGETKVWQYITLTKRIFLIDCPGVVYQNKDSETDIVLKGVVRVTNLEDAAEHIGEVLKRVKKEHLKRAYKIKDWVDENDFLLQLCKSTGKLLRVCLFLHFISWYLFFYDHITNLASVGHL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Nucleolar GTP-binding protein 2	GTPase that associates with pre-60S ribosomal subunits in the nucleolus and is required for their nuclear export and maturation.	probable	Q6CSP9
Nucleolar GTP-binding protein 2	GTPase that associates with pre-60S ribosomal subunits in the nucleolus and is required for their nuclear export and maturation.	probable	P53742
Nucleolar GTP-binding protein 2	GTPase that associates with pre-60S ribosomal subunits in the nucleolus and is required for their nuclear export and maturation.	probable	Q6FWS1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PUJ, chain A
Confidence level:very confident
Coverage over the Query: 198-332,345-457
View the alignment between query and template
View the model in PyMOL

Template: 3H2Y, chain A
Confidence level:very confident
Coverage over the Query: 182-185,200-429
View the alignment between query and template
View the model in PyMOL

Template: 1MKY, chain A
Confidence level:very confident
Coverage over the Query: 123-138,164-426
View the alignment between query and template
View the model in PyMOL