BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 012798
         (456 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3LSB|A Chain A, Crystal Structure Of The Mutant E241q Of Atrazine
           Chlorohydrolase Trzn From Arthrobacter Aurescens Tc1
           Complexed With Zinc And Ametrin
 pdb|3LSB|B Chain B, Crystal Structure Of The Mutant E241q Of Atrazine
           Chlorohydrolase Trzn From Arthrobacter Aurescens Tc1
           Complexed With Zinc And Ametrin
 pdb|3LSC|A Chain A, Crystal Structure Of The Mutant E241q Of Atrazine
           Chlorohydrolase Trzn From Arthrobacter Aurescens Tc1
           Complexed With Zinc And Atraton
 pdb|3LSC|B Chain B, Crystal Structure Of The Mutant E241q Of Atrazine
           Chlorohydrolase Trzn From Arthrobacter Aurescens Tc1
           Complexed With Zinc And Atraton
          Length = 456

 Score = 31.6 bits (70), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 8/57 (14%)

Query: 105 VFFLSLLG-ITPLAERLGYATEQLTFFTGATVGGLLNATFGNATELIISIYALKSGM 160
           V   SLLG IT +A+       Q  FF GAT    ++AT   AT+L I  +A +S M
Sbjct: 114 VLLESLLGGITTVAD-------QHLFFPGATADSYIDATIEAATDLGIRFHAARSSM 163


>pdb|3LS9|A Chain A, Crystal Structure Of Atrazine Chlorohydrolase Trzn From
           Arthrobacter Aurescens Tc1 Complexed With Zinc
 pdb|3LS9|B Chain B, Crystal Structure Of Atrazine Chlorohydrolase Trzn From
           Arthrobacter Aurescens Tc1 Complexed With Zinc
          Length = 456

 Score = 31.6 bits (70), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 8/57 (14%)

Query: 105 VFFLSLLG-ITPLAERLGYATEQLTFFTGATVGGLLNATFGNATELIISIYALKSGM 160
           V   SLLG IT +A+       Q  FF GAT    ++AT   AT+L I  +A +S M
Sbjct: 114 VLLESLLGGITTVAD-------QHLFFPGATADSYIDATIEAATDLGIRFHAARSSM 163


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.138    0.406 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,984,238
Number of Sequences: 62578
Number of extensions: 437378
Number of successful extensions: 1068
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1066
Number of HSP's gapped (non-prelim): 4
length of query: 456
length of database: 14,973,337
effective HSP length: 102
effective length of query: 354
effective length of database: 8,590,381
effective search space: 3040994874
effective search space used: 3040994874
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 53 (25.0 bits)