Citrus Sinensis ID: 012812

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450------
MLSVLRVHLPSDIPIVGCELTPYVLLRRPDNAVTTEDVPESAPIDGHFLRYKWYRIQSDRKVAVCSVHPSEQATLQCLGCVKAKIPVAKSYHCSPKCFSDAWQHHRVLHDRAASAVNENGNEEEELFGRFNSTGSGVINASLSGSASNSSLTNGSTPLYPAAVTRSGGETWFEVGRSKTYTPSADDIGHVLKFECVVVDAETKLPVGHPNTLLTSRVIPAPSPSPRRLFPVNGSDMNMMGHIDSDGRISSTGTFSVLSYNILSDVYATSESYSYCPSWALSWAYRRQNLLREIIGYRADIVCLQEVQNDHFEEFFAPELDKHGYQALYKRKTNEVYNGNPHTIDGCATFFRRDRFSHVKKYEVEFNKAAQSLTDAILPSAQKKNALNRLVKDNVALIVVLEAKFSNQGADTPGKRQLLCVANTHVNVHQELKDVKLWQVLIILLSSIFNYIFVSII
cccEEEEEccccccEEccEEEEEEEEEcccccccccccccccccccccEEEEEEEEccccccEEEccccccccccccccHHcccccccccccccHHHHHHHHHHHHHHcccHHHHccccccccHHcccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccEEEEEEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEcHccHHHHHHHHHHHHHHcccCEEEEcccccccccccccccEEEEEECcccEEEEEEEEEEEHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHcccccccccccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHccccc
**SVLRVHLPSDIPIVGCELTPYVLLRRPDNAVTTEDVPESAPIDGHFLRYKWYRIQSDRKVAVCSVHPSEQATLQCLGCVKAKIPVAKSYHCSPKCFSDAWQHHRVLHDR*************ELFGRFNSTGSGV*************************VTRSGGETWFEVGRSKTYTPSADDIGHVLKFECVVVDAETKLPVGHPNTLLTSRVIPAPSPSPRRLFPVNGSDM************SSTGTFSVLSYNILSDVYATSESYSYCPSWALSWAYRRQNLLREIIGYRADIVCLQEVQNDHFEEFFAPELDKHGYQALYKRKTNEVYNGNPHTIDGCATFFRRDRFSHVKKYEVEFNKAAQSLTDAILPSAQKKNALNRLVKDNVALIVVLEAKFSNQGADTPGKRQLLCVANTHVNVHQELKDVKLWQVLIILLSSIFNYIFVSII
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSVLRVHLPSDIPIVGCELTPYVLLRRPDNAVTTEDVPESAPIDGHFLRYKWYRIQSDRKVAVCSVHPSEQATLQCLGCVKAKIPVAKSYHCSPKCFSDAWQHHRVLHDRAASAVNENGNEEEELFGRFNSTGSGVINASLSGSASNSSLTNGSTPLYPAAVTRSGGETWFEVGRSKTYTPSADDIGHVLKFECVVVDAETKLPVGHPNTLLTSRVIPAPSPSPRRLFPVNGSDMNMMGHIDSDGRISSTGTFSVLSYNILSDVYATSESYSYCPSWALSWAYRRQNLLREIIGYRADIVCLQEVQNDHFEEFFAPELDKHGYQALYKRKTNEVYNGNPHTIDGCATFFRRDRFSHVKKYEVEFNKAAQSLTDAILPSAQKKNALNRLVKDNVALIVVLEAKFSNQGADTPGKRQLLCVANTHVNVHQELKDVKLWQVLIILLSSIFNYIFVSII

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Carbon catabolite repressor protein 4 homolog 1 Acts as catalytic component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover.probableQ8W0Z9

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.13.-Exoribonucleases producing 5'-phosphomonoesters.probable
3.1.13.4Poly(A)-specific ribonuclease.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NGQ, chain A
Confidence level:very confident
Coverage over the Query: 223-234,246-446
View the alignment between query and template
View the model in PyMOL
Template: 2D8Q, chain A
Confidence level:probable
Coverage over the Query: 63-110
View the alignment between query and template
View the model in PyMOL