BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 012828
         (455 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2EK8|A Chain A, Aminopeptidase From Aneurinibacillus Sp. Strain Am-1
 pdb|2EK9|A Chain A, Aminopeptidase From Aneurinibacillus Sp. Strain Am-1 With
           Bestatin
          Length = 421

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 99  LTGEAILVHRGGCSFTAKANFAEEANASAILIINN 133
           L G+  L+ RG  SF  K   A +  A A++I NN
Sbjct: 113 LNGKIALIQRGNISFADKVRNAAKQGAKAVIIYNN 147


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.140    0.441 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,033,612
Number of Sequences: 62578
Number of extensions: 523655
Number of successful extensions: 1032
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 11
Number of HSP's that attempted gapping in prelim test: 1030
Number of HSP's gapped (non-prelim): 12
length of query: 455
length of database: 14,973,337
effective HSP length: 102
effective length of query: 353
effective length of database: 8,590,381
effective search space: 3032404493
effective search space used: 3032404493
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)