Citrus Sinensis ID: 012837

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-----
MLMSGVCGGGGIRAWLKEKPLLRQFARRRRLFATSCSVASSKKEKVIVISGPTGAGKSQLALELAKRLNGEIISADSVQVYRGLDIGSAKPSSSDRKEVPHHLIDILHPCEDYSVGKFFEDARHATKDVLKKGRVPIVTGGTGLYLRWFIYGKPDVPKASPEIIAEVNSELADLQRDGDWYAAVEFVVKAGDPKARSLAANDWYRLRRSLEIIKSTGSPPSAFQIPYDSFREHSDSSETDHSYERNSSAGASDTNPKDLDYDFMCFFLSSHRLDLYRSIDLRCEDMLPGSDGILSEAAWLLDEGLLPNSNSATRAIGYRQAMEYLLRCRQQGGTSSTGEFYAFLAEFQKASRNFAKRQLTWFRNERIYHWLNAARPLENVLNYIITAYHDSTGTLVVPDYLQIRRDSSSSREVSELKSYRTRNRHFISRGDCCNILDWIKRTQGKTCELREPIVV
cccccccccccccccccccHHHHHHHHHHHcccccccccccccccEEEEEccccccHHHHHHHHHHHcccEEEEccHHHHHcccccccccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHcccccEEEcccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccHHccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHccccEEccccccHHHHHHHHHHccccccccccccc
******CGGGGIRAWLKEKPLLRQFARRRRLFATSCSVASSKKEKVIVISGPTGAGKSQLALELAKRLNGEIISADSVQVYRGLDIGSAKPSSSDRKEVPHHLIDILHPCEDYSVGKFFEDARHATKDVLKKGRVPIVTGGTGLYLRWFIYGKPDVPKASPEIIAEVNSELADLQRDGDWYAAVEFVVKAGDPKARSLAANDWYRLRRSLEIIKSTGSPPSAFQIP*DS************************TNPKDLDYDFMCFFLSSHRLDLYRSIDLRCEDMLPGSDGILSEAAWLLDEGLLPNSNSATRAIGYRQAMEYLLRCRQQGGTSSTGEFYAFLAEFQKASRNFAKRQLTWFRNERIYHWLNAARPLENVLNYIITAYHDSTGTLVVPDYLQI***************YRTRNRHFISRGDCCNILDWIKRTQGKTCELREPIVV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLMSGVCGGGGIRAWLKEKPLLRQFARRRRLFATSCSVASSKKEKVIVISGPTGAGKSQLALELAKRLNGEIISADSVQVYRGLDIGSAKPSSSDRKEVPHHLIDILHPCEDYSVGKFFEDARHATKDVLKKGRVPIVTGGTGLYLRWFIYGKPDVPKASPEIIAEVNSELADLQRDGDWYAAVEFVVKAGDPKARSLAANDWYRLRRSLEIIKSTGSPPSAFQIPYDSFREHSDSSETDHSYERNSSAGASDTNPKDLDYDFMCFFLSSHRLDLYRSIDLRCEDMLPGSDGILSEAAWLLDEGLLPNSNSATRAIGYRQAMEYLLRCRQQGGTSSTGEFYAFLAEFQKASRNFAKRQLTWFRNERIYHWLNAARPLENVLNYIITAYHDSTGTLVVPDYLQIRRDSSSSREVSELKSYRTRNRHFISRGDCCNILDWIKRTQGKTCELREPIVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
tRNA dimethylallyltransferase 9 Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A). Involved in the cis-type cytokinin biosynthesis.probableQ9C5J6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.5.-.-Transferring alkyl or aryl groups, other than methyl groups.probable
2.5.1.-5,10-methenyltetrahydromethanopterin hydrogenase.probable
2.5.1.75Transferred entry: 2.5.1.75.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A8T, chain A
Confidence level:very confident
Coverage over the Query: 42-159,191,258-374
View the alignment between query and template
View the model in PyMOL
Template: 3CRM, chain A
Confidence level:very confident
Coverage over the Query: 259-385
View the alignment between query and template
View the model in PyMOL
Template: 2QMH, chain A
Confidence level:confident
Coverage over the Query: 27-121
View the alignment between query and template
View the model in PyMOL