BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 012853
(455 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1QHU|A Chain A, Mammalian Blood Serum Haemopexin Deglycosylated And In
Complex With Its Ligand Haem
pdb|1QJS|A Chain A, Mammalian Blood Serum Haemopexin Glycosylated-Native
Protein And In Complex With Its Ligand Haem
pdb|1QJS|B Chain B, Mammalian Blood Serum Haemopexin Glycosylated-Native
Protein And In Complex With Its Ligand Haem
Length = 460
Score = 31.2 bits (69), Expect = 1.1, Method: Compositional matrix adjust.
Identities = 12/42 (28%), Positives = 23/42 (54%)
Query: 173 RSQADILKEAEEGWCDSKGTLEDVKTKIQMRQEGAFKRERAI 214
+ +AD++++ +GW TL+D T + + E +K R I
Sbjct: 43 KPEADVIEQCSDGWSFDATTLDDNGTMLFFKDEFVWKSHRGI 84
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.312 0.124 0.364
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,230,486
Number of Sequences: 62578
Number of extensions: 321101
Number of successful extensions: 529
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 528
Number of HSP's gapped (non-prelim): 1
length of query: 455
length of database: 14,973,337
effective HSP length: 102
effective length of query: 353
effective length of database: 8,590,381
effective search space: 3032404493
effective search space used: 3032404493
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 53 (25.0 bits)