Citrus Sinensis ID: 012893

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450----

MSEAAGSTQRRHVAVLAFPFGTHAAPLLDLVRRLSEAALEEEVTFSFFSTAQSNGSLFMEKDELRDCKIVPYNVESGLPEGFRFTGNPREPVEHFLKATPGNFVRALEKAVAKTGLEISCLITDAFLWFAAEMAEEMRVPWIAYWTAGPRSLLAHVDSDIIREIIGVNGPENQTLESIPGFSSIRAKDLPEGIISGPLDSPFPIMLDKMGKTLPKATVVAINSYEELDPIVVETLKSRFRKFLNVGPSTLTSPPPVSDPHGCLPWLNEHENASVIYISFGSMITPPRAEVIALAEALEAIGFPFLWSFRGNAEEQLPKGFLERTKSYGKVVPWAPQLKILEHSSVCVFVTHCGWNSTIEGITGGVPMVCRPVFADQALNQRIIETAWGIGVGVXGEKFTKDETVNALKQVLSSEEGKRMRENVGALKKLAFKAVESDGSSTKNFKALVEVVNMT

cccccccccccEEEEEcccccccHHHHHHHHHHHHHccccccEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHccccEEEcccccccccccccccccccHHcccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEECccccccccHHHHHHHcccccEEccccHHHHHcccccEEEcccccccHHHHHHHccccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcc

***********HVAVLAFPFGTHAAPLLDLVRRLSEAALEEEVTFSFFSTAQSNGSLFMEKDELRDCKIVPYNVESGLPEGFRFTGNPREPVEHFLKATPGNFVRALEKAVAKTGLEISCLITDAFLWFAAEMAEEMRVPWIAYWTAGPRSLLAHVDSDIIREIIGVNGPENQTLESIPGFSSIRAKDLPEGIISGPLDSPFPIMLDKMGKTLPKATVVAINSYEELDPIVVETLKSRFRKFLNVGPSTLT********HGCLPWLNEHENASVIYISFGSMITPPRAEVIALAEALEAIGFPFLWSFRGNAEEQLPKGFLERTKSYGKVVPWAPQLKILEHSSVCVFVTHCGWNSTIEGITGGVPMVCRPVFADQALNQRIIETAWGIGVGVXGEKFTKDETVNALKQVLSSEEGKRMRENVGALKKLAFKAVESDGSSTKNFKALVEVVNMT

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UDP-glycosyltransferase 78D2	Catalyzes the glycosylation of flavonoids from UDP-glucose. Catalyzes the glycosylation of anthocyanins from UDP-glucose. Possesses high quercetin 3-O-glucosyltransferase activity in vitro. Also active in vitro on benzoates and benzoate derivatives.	probable	Q9LFJ8
Anthocyanidin 3-O-glucosyltransferase 2	In the presence of other necessary color factors, this glycosylation reaction allows the accumulation of anthocyanin pigments. Anthocyanidins are the preferred substrates, while flavonols are only a minor substrate in vitro.	probable	Q5UL10
Flavonoid 3-O-glucosyltransferase	Catalyzes the glycosylation of flavonoids at the 3-O-position. Glycosylates the 7-O-position if the 3-O-position is not available. Also able to perform 3-O-glycosylation of anthocyanidins.	probable	A6XNC6

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.4.-.-	Glycosyltransferases.	probable
2.4.1.-	Hexosyltransferases.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2C1X, chain A
Confidence level:very confident
Coverage over the Query: 10-452
View the alignment between query and template
View the model in PyMOL